PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_14118.2
Common NameCCA1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family MYB_related
Protein Properties Length: 717aa    MW: 77740.4 Da    PI: 6.8173
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_14118.2genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.83.2e-152468147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rWT+ E++++++a k++G   W +I +++g ++t+ q++s+ qk+
     MLOC_14118.2 24 RERWTEAEHKRFLEALKLYGRA-WQRIEEHVG-TKTAVQIRSHAQKF 68
                     78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.84E-161874IPR009057Homeodomain-like
PROSITE profilePS5129419.1471973IPR017930Myb domain
TIGRFAMsTIGR015571.6E-162271IPR006447Myb domain, plants
SMARTSM007176.5E-122371IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.8E-82464IPR009057Homeodomain-like
PfamPF002491.5E-122467IPR001005SANT/Myb domain
CDDcd001671.03E-82669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0042754Biological Processnegative regulation of circadian rhythm
GO:0043433Biological Processnegative regulation of sequence-specific DNA binding transcription factor activity
GO:0046686Biological Processresponse to cadmium ion
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 717 aa     Download sequence    Send to blast
MEINSSGEET VIKVRKPYTI TKQRERWTEA EHKRFLEALK LYGRAWQRIE EHVGTKTAVQ  60
IRSHAQKFFT KLEKEAINNG TSPGQAHDID IPPPRPKRKP NCPYPRKGCL SSETPTREVP  120
KSSVSLSNSN SQMESNGTLQ VTSTQKLQRK ELSGNGSCSE VINIFREAPS ASFSSSNKSS  180
SNHGVSGGIE PTKTEIKDMA AMERKSTSVD VAKDVKDIND QEMERNNRVH ISSKYDRSHE  240
DCLDSSMKHM QLKPNTVETT YTGQHVASAP LYQMNKTGAT GTPDPGTEGS HPDQTNDQVG  300
GANGSMDCIH PTLPVDLKFG SSSTAQPFPH NYSGFAPTMQ CQCNQDAYRS SVDMSSTFSN  360
MLVSTLLSNP TVHAAARLAA SYWPAADSNI PVDPNQGIFA QNAQGRHIVS PPSMASVVAA  420
TVAAASAWWA TQGLLPLFAP PMAFPFVPVP TASFPTADVQ RATENCPVDN APKECQVAQG  480
QGQPEAMIVV ASSGSGESGK GEVCPHTELN ISLADKAETT PATGAETSDA LGNKKKQDRS  540
SCGSNTPSSS DVEAEHVPEN QDQANDKTQQ ACCSNSSAGD MNHRRFRNIS STNDSWKEVS  600
EEGRMAFDKL FSRGKLPQSF SPPQAEGLKV VPRGEQDEAT TVTVDLNKSA AVMDHELDTL  660
VGPRASFPIE LSHLNMKSRR TGFKPYKRCS VEAKENRVPA ADEVGTKRIR LDSEPST
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00654PBMTransfer from LOC_Os08g06110Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN6032420.0JN603242.1 Hordeum vulgare circadian clock associated 1 (CCA1) mRNA, complete cds.
GenBankAK3609660.0AK360966.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1129K17.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003573469.10.0PREDICTED: protein CCA1
RefseqXP_010234382.10.0PREDICTED: protein CCA1
RefseqXP_010234383.10.0PREDICTED: protein CCA1
RefseqXP_010234384.10.0PREDICTED: protein CCA1
TrEMBLF2DAQ20.0F2DAQ2_HORVD; Circadian clock associated 1
TrEMBLJ7FJ380.0J7FJ38_HORVU; Circadian clock associated 1
STRINGMLOC_14118.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60313447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46830.11e-40circadian clock associated 1
Publications ? help Back to Top
  1. Campoli C,Shtaya M,Davis SJ,von Korff M
    Expression conservation within the circadian clock of a monocot: natural variation at barley Ppd-H1 affects circadian expression of flowering time genes, but not clock orthologs.
    BMC Plant Biol., 2012. 12: p. 97
    [PMID:22720803]