PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_13019.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family MYB_related
Protein Properties Length: 287aa    MW: 29999.2 Da    PI: 6.1561
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_13019.2genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.84.4e-174690248
                     SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     g +++eE+e    +++ lG++ W++Iar+++ gRt++++k++w++yl
     MLOC_13019.2 46 GMFSPEEEETVMSLHAALGNK-WSRIARHLP-GRTDNEVKNYWNSYL 90
                     569******************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500904.391139IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.9E-92351IPR009057Homeodomain-like
SuperFamilySSF466893.89E-222595IPR009057Homeodomain-like
PROSITE profilePS5129425.1234094IPR017930Myb domain
SMARTSM007176.3E-144492IPR001005SANT/Myb domain
PfamPF002491.7E-154690IPR001005SANT/Myb domain
CDDcd001675.39E-124890No hitNo description
Gene3DG3DSA:1.10.10.604.2E-225291IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MSRKRNAHWI TGVNQNSPAR RAGLQRNGKS CRLRWINYLR PGLKHGMFSP EEEETVMSLH  60
AALGNKWSRI ARHLPGRTDN EVKNYWNSYL KKRVEGGKGA PNSPTPAAAS SAADSDGSQS  120
PSPGEVISTV QERASRPSNS AGSSEPPHES SSADSSCLTV TEPPACRAYA PVAPKVMFAD  180
WLNMDYIGGQ MGAAAAAAPG PEAAGVVGAG AGVGAGGGGD HCQVMSQGSS AQVDGPPGVE  240
DSLHGGFGDN GTCWEFLEQF DSMDQMQVGG GGGFCDLLSM TEFFALN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-19269540109B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ8587148e-99HQ858714.1 Zea mays clone UT1170 MYB transcription factor mRNA, partial cds.
GenBankBT0387448e-99BT038744.1 Zea mays full-length cDNA clone ZM_BFb0323B03 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003569964.11e-108PREDICTED: transcription factor LAF1
TrEMBLM0UQ290.0M0UQ29_HORVD; Uncharacterized protein
STRINGMLOC_13019.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP170737109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25560.12e-37myb domain protein 18