PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_12225.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family GeBP
Protein Properties Length: 275aa    MW: 29306.4 Da    PI: 5.0311
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_12225.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57335.13.6e-114534897
        DUF573 48 kvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97
                   +++sql+eK+rrL++K ++ ++++++g +p+  ++hd+++++l++++W+
  MLOC_12225.1  4 PYTRSQLSEKLRRLRNKHRGVSARVARGLDPARLAPHDRDVLHLCSRLWD 53
                  5789*********************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045041.5E-9453IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MPQPYTRSQL SEKLRRLRNK HRGVSARVAR GLDPARLAPH DRDVLHLCSR LWDPASAATS  60
PFAATGASAG SSGNKRRRAN PAPPPLPDVP APSGDSNSHG CYWIGSSIPG AAASFPDDNC  120
GGGEDVMYLE QENGHHLYFD EDAAFVADGN LNGITLDGIA LEQAETMAVL TDAGDNGVVG  180
NDYVAPPNVV NNGVSSENGN CNVLLPRSSE HRMASSVLDV FEECLREAKA DGMGSGGSAE  240
ESELARRWRA QRIDELDVLS RRLRLIIEDA TAAGH
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3731950.0AK373195.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3023H08.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010231034.11e-123PREDICTED: uncharacterized protein LOC100845859
TrEMBLF2EAM00.0F2EAM0_HORVD; Predicted protein
TrEMBLM0UMB10.0M0UMB1_HORVD; Uncharacterized protein
STRINGMLOC_12225.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP86953243