PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_11838.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family LBD
Protein Properties Length: 277aa    MW: 29479.9 Da    PI: 8.5043
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_11838.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26044.93.4e-141777156
        DUF260  1 aCaaCkvlrrkCakdCvlapyf.....paeqpkkfanvhklFGasnvlkllkalpeeered 56
                  +C++C+vlr++C++ C+l+p++     +++q +++ +++k+FG++ ++++l+a+pe++r+ 
  MLOC_11838.1 17 SCNGCRVLRKGCNDACMLRPCLlwiegADAQGHATIFAAKFFGRAGLMSFLTAVPESQRPG 77
                  6*********************9999877889**************************975 PP

2DUF26029.91.6e-091171585697
        DUF260  56 damsslvyeAearardPvyGavgvilklqqqleqlkaelall 97 
                   ++++sl+yeA  r+ +Pv Gavg++++++++l++++++++l+
  MLOC_11838.1 117 AVFQSLLYEAAGRTINPVGGAVGLLWAGSWHLCEAAVQTVLR 158
                   679********************************9998776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512576118No hitNo description
PROSITE profilePS5089110.37316162IPR004883Lateral organ boundaries, LOB
PfamPF031955.9E-111776IPR004883Lateral organ boundaries, LOB
PfamPF031954.0E-6117156IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006807Biological Processnitrogen compound metabolic process
GO:0060776Biological Processsimple leaf morphogenesis
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MRGSERAAVS TSTSGMSCNG CRVLRKGCND ACMLRPCLLW IEGADAQGHA TIFAAKFFGR  60
AGLMSFLTAV PESQRPGTHA RTDWGSMLFF FFFFFLVRRF ICCLWLMFVW CLLRIAAVFQ  120
SLLYEAAGRT INPVGGAVGL LWAGSWHLCE AAVQTVLRGG AIRPLPELAG GVPEGGVGGS  180
DLFASSSRRA VVGCSTYSMA KRVTPRKTWA PEAASHHQEP SCDLGLFLTP GSAAAAEGER  240
RARRAGTPSM SSDGSVTTTA GAGADGDKEP ELLNLFV
Cis-element ? help Back to Top
SourceLink
PlantRegMapMLOC_11838.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3638590.0AK363859.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2019I02.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020191646.11e-132LOB domain-containing protein 37-like
TrEMBLM0UKU40.0M0UKU4_HORVV; Uncharacterized protein
STRINGMLOC_11838.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP40843675
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G67420.16e-55LOB domain-containing protein 37