PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_11474.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family M-type_MADS
Protein Properties Length: 387aa    MW: 43024.5 Da    PI: 6.39
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_11474.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF67.21.6e-211053245
                  ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
        SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                  + en+s rqvt+skRr gilKKA+ELS+LCd++  +++fs++g+
  MLOC_11474.1 10 KLENSSGRQVTYSKRRSGILKKAKELSILCDIDLILLMFSPSGR 53
                  679**************************************995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004325.2E-29160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006624.6153IPR002100Transcription factor, MADS-box
SuperFamilySSF554555.89E-25295IPR002100Transcription factor, MADS-box
PRINTSPR004043.2E-17323IPR002100Transcription factor, MADS-box
PfamPF003196.7E-191154IPR002100Transcription factor, MADS-box
PRINTSPR004043.2E-172338IPR002100Transcription factor, MADS-box
PRINTSPR004043.2E-173859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MGRVKLKIKK LENSSGRQVT YSKRRSGILK KAKELSILCD IDLILLMFSP SGRPTICIGD  60
KSPIDEVIAK YAQQTPQERA KRKLESLEAL KKTFKKLDHD VNIQDFLGSG GQTVEELSSH  120
LGALQCQMAD VQKRLSYWSD PEKVENIDHI RAMEQSLKES LNRIGIYKEN FAKQHLMGLQ  180
CAAAQFQNDM QLPLGLTGDP NPSSWFHNGV GSDGQPPMML PEDPSLLHQR DIGCSTSTSL  240
QSYPGYFSMS KQSTDTAGGE QQHQQAAALQ QHQHQQPEFS QGDCLTSLHL GAQFPYQSAF  300
DHTSLLNDRL FRPDMELHVD NAAASAMDFV GGHYEMPRPG DEASFQNWAS AACGATMYDH  360
QQQAPSAQLI VQNMTESLTV SSLQQQL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A7e-13192190MEF2 CHIMERA
6byy_B7e-13192190MEF2 CHIMERA
6byy_C7e-13192190MEF2 CHIMERA
6byy_D7e-13192190MEF2 CHIMERA
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapMLOC_11474.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3731110.0AK373111.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3021H04.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020192405.10.0agamous-like MADS-box protein AGL65
TrEMBLF2EAD60.0F2EAD6_HORVV; Predicted protein
STRINGMLOC_11474.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP46263659
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18750.15e-73AGAMOUS-like 65