PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_10707.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family MYB_related
Protein Properties Length: 429aa    MW: 48109.6 Da    PI: 4.9685
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_10707.1genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding37.74.7e-12264310147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r+ WT+eE++ ++ + k +G g+Wk I++++  ++t+ q+ s+ qk+
     MLOC_10707.1 264 RKYWTEEEHKSFLYGLKVYGRGDWKNISKHFVSTKTPIQVSSHAQKF 310
                      678*****************************99***********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.556259315IPR017930Myb domain
SuperFamilySSF466893.88E-16262316IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-13263313IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.603.0E-9263317IPR009057Homeodomain-like
SMARTSM007177.9E-11263313IPR001005SANT/Myb domain
PfamPF002491.1E-8264309IPR001005SANT/Myb domain
CDDcd001678.11E-9267311No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 429 aa     Download sequence    Send to blast
MDSIVNQGWT SSEVEEAWSL IASLNTKKIV YDDNDDKNKK HNYIVNSLHA LFPSKTMKQV  60
TDLYVNLAME MHMIQRREGT HFTGGTPQNS FTFCDTVNGK FELPGEENGT SSTHGVYTLG  120
SHANDNFGVR EEATMMDNNG LSFGCAMEDM GITVTGEAPQ MIDNNKMEVL ENNIFIDQPV  180
VVPHQWGFWT GEEHSNGDLV NENFEIQEGV DTTMDDNGFS FPYALEDTRI AKMEEAQMMV  240
DKNKMVVLEN NTCNDRPVVA PHQRKYWTEE EHKSFLYGLK VYGRGDWKNI SKHFVSTKTP  300
IQVSSHAQKF FKRIQKKASS GTKRYSINDV RLDDNDLLAA NNSSAPRQAL SFTGLNNNPS  360
FKLQAPTSSF TVMNNLAQCS PSIYNQQVGQ QPMWSDRKMM GSVGAVMDGV ANDVPDGQQG  420
SAYFYLGNV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLM0UGD70.0M0UGD7_HORVD; Uncharacterized protein
STRINGMLOC_10707.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP84230133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.11e-20Homeodomain-like transcriptional regulator