PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G045358.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family LBD
Protein Properties Length: 233aa    MW: 25080.2 Da    PI: 5.6514
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G045358.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260134.93e-42481471100
                DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89 
                           +CaaCk+lrr+Ca++Cvlapyfp ++p+kf ++h++FGasn++k+l++lpe++r da+ss+vyeA ar+rdPvyG++g i +lq+q+ +
  HL.SW.v1.0.G045358.1  48 PCAACKILRRRCADKCVLAPYFPPTEPAKFTIAHRVFGASNIIKFLQELPESQRADAVSSMVYEAGARIRDPVYGCAGAICQLQKQVGE 136
                           7**************************************************************************************** PP

                DUF260  90 lkaelallkee 100
                           l+a+la++++e
  HL.SW.v1.0.G045358.1 137 LQAQLAKAQAE 147
                           ******99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.87947148IPR004883Lateral organ boundaries, LOB
PfamPF031952.8E-4248145IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MECSTETNTT TTASSSPPLA SQYSSNSSSS SPPQTPNPSP NPPVVLSPCA ACKILRRRCA  60
DKCVLAPYFP PTEPAKFTIA HRVFGASNII KFLQELPESQ RADAVSSMVY EAGARIRDPV  120
YGCAGAICQL QKQVGELQAQ LAKAQAEVVN MQCQQANLVA LLCMEMAQSQ QGYNNNNNSP  180
PHHQQISLDG SLMINNITST TTPLMISNQS NNSLSFLDDN NNLGSMWEPL WT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-43391552118LOB family transfactor Ramosa2.1
5ly0_B3e-43391552118LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010104136.11e-106LOB domain-containing protein 1
SwissprotQ9SK084e-75LBD11_ARATH; LOB domain-containing protein 11
TrEMBLA0A2P5FF341e-114A0A2P5FF34_TREOI; Lateral organ boundaries domain containing protein
STRINGXP_010104136.11e-105(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.17e-61LOB domain-containing protein 11