PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G044101.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family HD-ZIP
Protein Properties Length: 842aa    MW: 91293.1 Da    PI: 5.9818
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G044101.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.14.7e-21130185156
                           TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
              Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                           +++ +++t++q++eLe+lF+++++p++++r eL+k+l L++rqVk+WFqNrR+++k
  HL.SW.v1.0.G044101.1 130 KKRYHRHTPQQIQELEALFKECPHPDEKQRLELSKRLCLETRQVKFWFQNRRTQMK 185
                           688999***********************************************999 PP

2START209.11.7e-653355601206
                           HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S... CS
                 START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla... 77 
                           ela++a++elvk+a+ eep+W ks+    + +n++e++++f +  +     + ++a+r+sg+v+ ++  lve+l++++ +W e+++   
  HL.SW.v1.0.G044101.1 335 ELALAAMDELVKMAQTEEPLWIKSYeggrDVLNQEEYMRSFNPCIGmkpsgFVTDASRESGIVIINSLALVETLMESS-RWAEMFPcvi 422
                           5899*************************************99888999999**************************.********** PP

                           .EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--..-TTSEE-EESSEEEEEEEE CS
                 START  78 .kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.sssvvRaellpSgiliepk 157
                            + +t++vissg      galqlm aelq+lsplvp R++ f+R+++q+ +g+w++vdvS+d  +++++  +s++ +++lpSg++++++
  HL.SW.v1.0.G044101.1 423 aRTSTTDVISSGmggtrnGALQLMHAELQVLSPLVPvREVNFLRFCKQHAEGVWAVVDVSIDTIRDNSSgPPSFINCRRLPSGCVVQDM 511
                           ********************************************************************999****************** PP

                           CTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                 START 158 snghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                           + g+skvtwveh++++++++h+l+r+l++sg+ +ga++wvatlqrqce+
  HL.SW.v1.0.G044101.1 512 PSGYSKVTWVEHAEYDESQVHQLYRPLLSSGMGFGAQRWVATLQRQCEC 560
                           ***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.03E-20112187IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.5E-22117187IPR009057Homeodomain-like
PROSITE profilePS5007117.216127187IPR001356Homeobox domain
SMARTSM003899.9E-18128191IPR001356Homeobox domain
CDDcd000861.38E-18129187No hitNo description
PfamPF000461.4E-18130185IPR001356Homeobox domain
PROSITE patternPS000270162185IPR017970Homeobox, conserved site
PROSITE profilePS5084843.618326563IPR002913START domain
SuperFamilySSF559611.65E-34328560No hitNo description
CDDcd088758.70E-122330559No hitNo description
PfamPF018523.4E-58335560IPR002913START domain
SMARTSM002341.5E-50335560IPR002913START domain
SuperFamilySSF559619.89E-24589759No hitNo description
SuperFamilySSF559619.89E-24794834No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009827Biological Processplant-type cell wall modification
GO:0042335Biological Processcuticle development
GO:0043481Biological Processanthocyanin accumulation in tissues in response to UV light
GO:0048765Biological Processroot hair cell differentiation
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 842 aa     Download sequence    Send to blast
MSFGGFLDNS TSTSGGGARL VAEIPYSSTS NDNIGNGNDN NHIMPSTAIA QPRLITQSLT  60
KSMFNSPGLS LALQTNRDGQ GDMIRNMAES FEPGSGRRSR DEEHESRSGS DNMDGGSGDD  120
QDATDKPPRK KRYHRHTPQQ IQELEALFKE CPHPDEKQRL ELSKRLCLET RQVKFWFQNR  180
RTQMKTQLER HENSLLRQEN DKLRAENMSI RDAMRNPMCT NCGGPAIIGE ISLEEQHLRI  240
ENARLKDELE RVCSLAGKFL GRPISALATS MAPPLPSSAL ELGVGSNGFG GLTSVTTTMP  300
DFGISSNTLA VLPQSRSQGG VQVLDRSIER SMYLELALAA MDELVKMAQT EEPLWIKSYE  360
GGRDVLNQEE YMRSFNPCIG MKPSGFVTDA SRESGIVIIN SLALVETLME SSRWAEMFPC  420
VIARTSTTDV ISSGMGGTRN GALQLMHAEL QVLSPLVPVR EVNFLRFCKQ HAEGVWAVVD  480
VSIDTIRDNS SGPPSFINCR RLPSGCVVQD MPSGYSKVTW VEHAEYDESQ VHQLYRPLLS  540
SGMGFGAQRW VATLQRQCEC LAILMSSTVP TRDHTAGITP GGRRSMLKLA QRMTDNFCAG  600
VCASTVHKWN KLNAGNVDED VRVMTRKSVD DPGEPPGIVL SAATSVWLPV SPQRLFDFLR  660
DESLRSEWDI LSNGGPMQEM AHIAKGQNHG NCVSLLRASA MNTNQSSMLI LQETCIDEAG  720
SLVVYAPVDI PAMHVVMNGG DSAYVALLPS GFAIVPDGPG SRGPNMGPTA NGGGNNNGGS  780
GSNGNGGDGS HRVGGSLLTV AFQILVNSLP TAKLTVESVE TVNNLISCTV QKIKAALQCE  840
S*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00421DAPTransfer from AT4G00730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024018220.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A2P5CNQ40.0A0A2P5CNQ4_TREOI; Octamer-binding transcription factor
STRINGXP_010091553.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]