PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G043571.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family HD-ZIP
Protein Properties Length: 294aa    MW: 32070.8 Da    PI: 8.3957
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G043571.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox581.6e-18145199256
                           T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
              Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                           rk+ ++tkeq   Lee F+++++++ ++++ LA++l+L  rqV vWFqNrRa+ k
  HL.SW.v1.0.G043571.1 145 RKKLRLTKEQSALLEESFKQHSTLNPRQKQALARQLNLRPRQVEVWFQNRRARTK 199
                           788899***********************************************98 PP

2HD-ZIP_I/II124.83.9e-40145234191
           HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                           +kk+rl+keq++lLEesF+++++L+p++K++lar+L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lk+++++l++en+rL+ke +eL+ 
  HL.SW.v1.0.G043571.1 145 RKKLRLTKEQSALLEESFKQHSTLNPRQKQALARQLNLRPRQVEVWFQNRRARTKLKQTEVDCEFLKKCCETLTDENRRLQKELQELK- 232
                           69*************************************************************************************9. PP

           HD-ZIP_I/II  90 el 91 
                           +l
  HL.SW.v1.0.G043571.1 233 AL 234
                           54 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.9E-18131195IPR009057Homeodomain-like
SuperFamilySSF466896.27E-19134202IPR009057Homeodomain-like
PROSITE profilePS5007117.54141201IPR001356Homeobox domain
SMARTSM003891.9E-15143205IPR001356Homeobox domain
PfamPF000466.3E-16145199IPR001356Homeobox domain
CDDcd000866.52E-17145202No hitNo description
PROSITE patternPS000270176199IPR017970Homeobox, conserved site
SMARTSM003401.1E-25201244IPR003106Leucine zipper, homeobox-associated
PfamPF021835.7E-10201235IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009735Biological Processresponse to cytokinin
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MGFDDLCNTG LDLGLGFTAS AASTKKPSTN STTTSATTTS FEPSLTLGLS GDPYNSSNNA  60
RKISTINIDV NKGGGTTCHE ETVNNNNSNN NIDLYRQASP HSAVSSFSGG GGRVKRERDL  120
SSEEIEVEKV SSRISDEDDD GPNARKKLRL TKEQSALLEE SFKQHSTLNP RQKQALARQL  180
NLRPRQVEVW FQNRRARTKL KQTEVDCEFL KKCCETLTDE NRRLQKELQE LKALKLSQPL  240
YMHMPAATLT MCPSCERIGG VGVGAGDGAS KSPFSMASKP HFYNPFTNPS AAC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1193201RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00477DAPTransfer from AT4G37790Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_017970499.11e-152PREDICTED: homeobox-leucine zipper protein HAT22
SwissprotP466041e-101HAT22_ARATH; Homeobox-leucine zipper protein HAT22
TrEMBLA0A2P5F2Y11e-171A0A2P5F2Y1_TREOI; Octamer-binding transcription factor
STRINGEOX917921e-151(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114433107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.12e-84HD-ZIP family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Liu T,Longhurst AD,Talavera-Rauh F,Hokin SA,Barton MK
    The Arabidopsis transcription factor ABIG1 relays ABA signaled growth inhibition and drought induced senescence.
    Elife, 2017.
    [PMID:27697148]
  3. Song L, et al.
    A transcription factor hierarchy defines an environmental stress response network.
    Science, 2017.
    [PMID:27811239]