PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G043513.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family Nin-like
Protein Properties Length: 352aa    MW: 40428 Da    PI: 4.9882
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G043513.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK82.34.7e-26176226252
                RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                           +k++s ++ls+y+++pi++AAkeL+v+lT+LK++CR++GI+RWPhRk+ sl
  HL.SW.v1.0.G043513.1 176 SKRLSRQVLSQYYYMPITQAAKELNVGLTLLKKRCRELGISRWPHRKLMSL 226
                           689*********************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.268160248IPR003035RWP-RK domain
PfamPF020421.7E-21179226IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 352 aa     Download sequence    Send to blast
MGSQGHVFTT SNFRPNHEMV AIDENPFPHI STDQYFSSSD FDNFFSSWEY NWQYDQYLPV  60
VQESYLLDPV PLMEYYPTNP LYSTAGLDPI IHDEFLSNNG NIGFGIWEDF GPLGFEPNSL  120
DEVNKEPFSV CSNIDSNYGD HGNGKDKTKK ERQMFKRSYR SSVVISEEKS SGTSSSKRLS  180
RQVLSQYYYM PITQAAKELN VGLTLLKKRC RELGISRWPH RKLMSLQTLI KNVQDLRNGE  240
SSEENDSRYK QYIELLEREK KLVEEVPNIE LNDGTKRLRQ ACFKNNYKKR KMRSTSGYDS  300
GLMSSKKYCS SDEMQGGAGM TNDLDEEDDE IKFLLSESFS STDLHLAIEI S*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024018219.13e-80protein RKD2
TrEMBLA0A2P5F7331e-111A0A2P5F733_TREOI; RWP-RK domain containing protein
STRINGXP_010091523.13e-80(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF61843052
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66990.15e-40RWP-RK domain-containing protein