PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G041758.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family LBD
Protein Properties Length: 253aa    MW: 27544.9 Da    PI: 8.7283
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G041758.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260134.54e-42451441100
                DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89 
                           +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv+k+l ++pe++r da++slvyeA++r+rdPvyG++g i++lqqq+++
  HL.SW.v1.0.G041758.1  45 PCAACKLLRRRCAQECPFSPYFSPHEPHKFASVHKVFGASNVSKMLMEVPESQRADAANSLVYEANVRLRDPVYGCMGAISALQQQVQS 133
                           7**************************************************************************************** PP

                DUF260  90 lkaelallkee 100
                           l+ael+++++e
  HL.SW.v1.0.G041758.1 134 LQAELNAVRAE 144
                           *******9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.91744145IPR004883Lateral organ boundaries, LOB
PfamPF031953.7E-4245142IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 253 aa     Download sequence    Send to blast
MSRERERFDE IGKKIKRESS TDAGAHQMGR RHMLGPPGTL NTITPCAACK LLRRRCAQEC  60
PFSPYFSPHE PHKFASVHKV FGASNVSKML MEVPESQRAD AANSLVYEAN VRLRDPVYGC  120
MGAISALQQQ VQSLQAELNA VRAEILRYKY REATTTTNNN NNNNSIINPS SSSSLHHHHH  180
LHHLALLSSN NSGNVSVAAP PPAGAPPQPP PPPQISTVQS LPITTTTSSS SSMYTTAEDY  240
NTISSENVPF FG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-45371523118LOB family transfactor Ramosa2.1
5ly0_B2e-45371523118LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023925198.11e-109LOB domain-containing protein 15
SwissprotQ8L5T56e-89LBD15_ARATH; LOB domain-containing protein 15
TrEMBLA0A2P5AHJ81e-122A0A2P5AHJ8_TREOI; Wilm's tumor protein
STRINGVIT_13s0067g02380.t011e-108(Vitis vinifera)
STRINGcassava4.1_029925m1e-108(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22983486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.12e-88LOB domain-containing protein 15
Publications ? help Back to Top
  1. Ohashi-Ito K,Iwamoto K,Fukuda H
    LOB DOMAIN-CONTAINING PROTEIN 15 Positively Regulates Expression of VND7, a Master Regulator of Tracheary Elements.
    Plant Cell Physiol., 2018. 59(5): p. 989-996
    [PMID:29444288]