PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G038526.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family ARR-B
Protein Properties Length: 691aa    MW: 75778.7 Da    PI: 6.3495
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G038526.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like83.91.7e-26209262155
               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                           +pr++W+peLH++F  av++L G ekA+Pk+il+lm+ +gLt+e+v+SHLQkYRl
  HL.SW.v1.0.G038526.1 209 RPRVVWSPELHKKFCAAVHKL-GLEKAVPKKILDLMNDEGLTRENVASHLQKYRL 262
                           59*******************.********************************8 PP

2Response_reg80.36.5e-27231311109
                           EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHH CS
          Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedal 87 
                           vl vdD+p+ +++l+++l+k +y +v+++ ++ +al++l+e++  +Dl++ D++mp+mdG++ll+     e++lp+i+++a ++ +++ 
  HL.SW.v1.0.G038526.1  23 VLAVDDNPTCLRVLESLLRKCQY-QVTTTNQAIKALKMLRENRnrFDLVISDVNMPDMDGFKLLELVGL-EMDLPVIMLSALSDTKLVM 109
                           799********************.***************999889*******************87754.558**************** PP

                           HHHHTTESEEEESS--HHHHHH CS
          Response_reg  88 ealkaGakdflsKpfdpeelvk 109
                           + +  Ga d+l Kp+ +eel +
  HL.SW.v1.0.G038526.1 110 KGITHGAVDYLLKPVRIEELKN 131
                           *******************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363921.2E-1581690IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23002.0E-4220168No hitNo description
SuperFamilySSF521724.98E-3620143IPR011006CheY-like superfamily
SMARTSM004486.9E-3321133IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011043.88822137IPR001789Signal transduction response regulator, receiver domain
PfamPF000722.5E-2423131IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.16E-2824137No hitNo description
PROSITE profilePS5129410.235206265IPR017930Myb domain
SuperFamilySSF466893.76E-18206266IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.2E-28207267IPR009057Homeodomain-like
TIGRFAMsTIGR015575.8E-23210262IPR006447Myb domain, plants
PfamPF002491.0E-8211261IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0009736Biological Processcytokinin-activated signaling pathway
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 691 aa     Download sequence    Send to blast
MTVEDQRGED GGAFDRFPVG MRVLAVDDNP TCLRVLESLL RKCQYQVTTT NQAIKALKML  60
RENRNRFDLV ISDVNMPDMD GFKLLELVGL EMDLPVIMLS ALSDTKLVMK GITHGAVDYL  120
LKPVRIEELK NIWQHVIRRK KLDPCDQNKQ SDQEKNCHES GEGGNGVTST GLDQNAKTNR  180
KRKDQDEDEE EEGEYDEQES EDPSSTQKRP RVVWSPELHK KFCAAVHKLG LEKAVPKKIL  240
DLMNDEGLTR ENVASHLQKY RLYLKRINTE AIQQASVLAS LRVKDSSYVH IDALDGFGDM  300
HTMNGSVRLA NSALSSSYTH GGMLGRLNSP SGLTIRGISS NGLIQPGNSQ SLSNSFSTLG  360
KFHSSMSVNQ SSSLFQGIPT LELNKLQQQH TKSTTHIGEF NPLNNSTGFA VPASFPDLRV  420
TPGSSGIVCN SSSNPLILQP RHSRGVLGDQ SSVRVTPLLP QSFDSESRGS SNFLDHNRCS  480
ESWQVAVQSS KFPPTALPMS EPSNHGHIHT NNLGIPSTSA QIGNNPRAFS STSAFLAPLA  540
GTRDGQGHGD FIGNVVQSTN YTEKQRWGNH KLNQNFGALN SMVSANNTMG SLNQTLGQNS  600
AIYSENFGRS IVDQLNGCTS SVFGNSAMVA KTETNEDYLL DQSKAHDDFI QNSYESLDDI  660
MTAMMKRGQS ETIIMDGEFG VDAYPLGSCI *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-23205268164ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023908185.10.0two-component response regulator ARR12-like isoform X1
TrEMBLA0A2P5ETE60.0A0A2P5ETE6_TREOI; Two-component response regulator
STRINGXP_008242944.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-123response regulator 12