PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G038419.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family LBD
Protein Properties Length: 197aa    MW: 21870.5 Da    PI: 10.3546
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G038419.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260108.93.9e-344312914100
                DUF260  14 kdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                           + C +apyfpae p+kfanvhk+FGasnv kll+++ +++r+da++sl+yeA+ r+rdPvyG+vgvi+ lq+ql+ql+ +l+++k+e
  HL.SW.v1.0.G038419.1  43 SACLFAPYFPAEPPQKFANVHKVFGASNVAKLLNEVAPSQRKDAVNSLAYEADTRLRDPVYGCVGVITLLQHQLRQLQMDLSSTKSE 129
                           57********************************************************************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089119.4129130IPR004883Lateral organ boundaries, LOB
PfamPF031953.1E-3343127IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MAGFLAKLFV TTKREREVRT CRWRLRVRRA RGVRCCGGSA IRSACLFAPY FPAEPPQKFA  60
NVHKVFGASN VAKLLNEVAP SQRKDAVNSL AYEADTRLRD PVYGCVGVIT LLQHQLRQLQ  120
MDLSSTKSEL SKYQNLGLIA HHHHQMINYD ATTTLPVPDM NVSDQFIRST NLGPPPPGIM  180
TAAPLMIPRL YIALAL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-394413325114LOB family transfactor Ramosa2.1
5ly0_B2e-394413325114LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtNegative regulator of cell proliferation in the adaxial side of leaves. Regulates the formation of a symmetric lamina and the establishment of venation. Positively regulates LATERAL ORGAN BOUNDARIES (LOB) within the shoot apex, and the class III HD-ZIP genes REV, PHB, and PHV. Interacts directly with ASYMMETRIC LEAVES 1 (AS1) to repress the knox homeobox genes KNAT1, KNAT2, and KNAT6 and the abaxial determinants ARF3, KAN2 and YAB5. May act in parallel with the RDR6-SGS3-AGO7 pathway, an endogenous RNA silencing pathway, to regulate the leaf morphogenesis (PubMed:11311158, PubMed:12787254, PubMed:12874130, PubMed:14508003, PubMed:16006579, PubMed:16699177, PubMed:17395603, PubMed:17559509). Required for the binding of AS1 to the KNOX genes (PubMed:23271976). Involved in leaf polarity establishment by functioning cooperatively with RH10 or RID2 to repress abaxial genes ARF3, ARF4, KAN1, KAN2, YAB1 and YAB5, and the knox homeobox genes KNAT1, KNAT2, KNAT6, and STM to promote adaxial development in leaf primordia at shoot apical meristems at high temperatures (PubMed:27334696). {ECO:0000269|PubMed:11311158, ECO:0000269|PubMed:12787254, ECO:0000269|PubMed:12874130, ECO:0000269|PubMed:14508003, ECO:0000269|PubMed:16006579, ECO:0000269|PubMed:16699177, ECO:0000269|PubMed:17395603, ECO:0000269|PubMed:17559509, ECO:0000269|PubMed:23271976, ECO:0000269|PubMed:27334696}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by SHOOT MERISTEMLESS (STM). {ECO:0000269|PubMed:11934861}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotO044792e-44AS2_ARATH; Protein ASYMMETRIC LEAVES 2
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.46e-47LBD family protein
Publications ? help Back to Top
  1. Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y
    The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis.
    Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71
    [PMID:26108442]
  2. Mateo-BonmatĂ­ E, et al.
    Plastid control of abaxial-adaxial patterning.
    Sci Rep, 2015. 5: p. 15975
    [PMID:26522839]
  3. Li Z, et al.
    Transcription factors AS1 and AS2 interact with LHP1 to repress KNOX genes in Arabidopsis.
    J Integr Plant Biol, 2016. 58(12): p. 959-970
    [PMID:27273574]
  4. Matsumura Y, et al.
    A genetic link between epigenetic repressor AS1-AS2 and a putative small subunit processome in leaf polarity establishment of Arabidopsis.
    Biol Open, 2016. 5(7): p. 942-54
    [PMID:27334696]
  5. Wang Z,Wang Y,Kohalmi SE,Amyot L,Hannoufa A
    SQUAMOSA PROMOTER BINDING PROTEIN-LIKE 2 controls floral organ development and plant fertility by activating ASYMMETRIC LEAVES 2 in Arabidopsis thaliana.
    Plant Mol. Biol., 2016. 92(6): p. 661-674
    [PMID:27605094]
  6. Vial-Pradel S, et al.
    Arabidopsis Zinc-Finger-Like Protein ASYMMETRIC LEAVES2 (AS2) and Two Nucleolar Proteins Maintain Gene Body DNA Methylation in the Leaf Polarity Gene ETTIN (ARF3).
    Plant Cell Physiol., 2018. 59(7): p. 1385-1397
    [PMID:29415182]
  7. Silverblatt-Buser EW,Frick MA,Rabeler C,Kaplinsky NJ
    Genetic Interactions Between BOB1 and Multiple 26S Proteasome Subunits Suggest a Role for Proteostasis in Regulating Arabidopsis Development.
    G3 (Bethesda), 2018. 8(4): p. 1379-1390
    [PMID:29487187]