PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G034824.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family ARR-B
Protein Properties Length: 679aa    MW: 74581.7 Da    PI: 6.584
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G034824.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like88.37.3e-28198251155
               G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                           kpr++W+ eLH++Fv av++L G++kA+Pk+il+lm+v+ Lt+e+v+SHLQkYRl
  HL.SW.v1.0.G034824.1 198 KPRVVWSVELHRKFVTAVHHL-GIDKAVPKKILDLMNVDKLTRENVASHLQKYRL 251
                           79*******************.********************************8 PP

2Response_reg76.78.4e-26161241109
                           EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHH CS
          Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedal 87 
                           vl vdD+p+ + ll+++l++ +y +v++ +++ +al++l+e++  +Dl++ D+ mp+mdG++ll+     e++lp+i+++++g+++++ 
  HL.SW.v1.0.G034824.1  16 VLAVDDDPTCLLLLETLLRRCQY-HVTTSSQAVAALNMLRENRnkFDLVISDVHMPDMDGFKLLELVGL-EMDLPVIMLSGNGDPKLVM 102
                           799********************.***************999889*******************87754.558**************** PP

                           HHHHTTESEEEESS--HHHHHH CS
          Response_reg  88 ealkaGakdflsKpfdpeelvk 109
                           + +  Ga d+l Kp+ +eel +
  HL.SW.v1.0.G034824.1 103 KGITHGACDYLLKPVRIEELKN 124
                           *******************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363922.5E-1601670IPR017053Response regulator B-type, plant
SuperFamilySSF521726.69E-3613135IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23002.8E-4213148No hitNo description
SMARTSM004488.3E-3214126IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.99315130IPR001789Signal transduction response regulator, receiver domain
PfamPF000727.6E-2316124IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.91E-2317130No hitNo description
PROSITE profilePS5129413.024195254IPR017930Myb domain
SuperFamilySSF466891.33E-19195255IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-29196256IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-25198251IPR006447Myb domain, plants
PfamPF002491.1E-6200250IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0009414Biological Processresponse to water deprivation
GO:0010082Biological Processregulation of root meristem growth
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0031537Biological Processregulation of anthocyanin metabolic process
GO:0048367Biological Processshoot system development
GO:0080022Biological Processprimary root development
GO:0080036Biological Processregulation of cytokinin-activated signaling pathway
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 679 aa     Download sequence    Send to blast
MTVDDARDQF PIGMRVLAVD DDPTCLLLLE TLLRRCQYHV TTSSQAVAAL NMLRENRNKF  60
DLVISDVHMP DMDGFKLLEL VGLEMDLPVI MLSGNGDPKL VMKGITHGAC DYLLKPVRIE  120
ELKNIWQHVI RRKKKDTKSQ KNSSNQDKSN GACEGEPGFA GPGNSDQKVN KKRKDQIDDD  180
EDENDDNGDS DDPSTQKKPR VVWSVELHRK FVTAVHHLGI DKAVPKKILD LMNVDKLTRE  240
NVASHLQKYR LYLKRISCHA NQHANMEAAL RSSDSSYLRM GSMNGLGNFN ALNGSMQYQN  300
PAFRSFPPSG MVSRLNSPSA MGLRCLPSSG MVQLSHAQNS NSSHDQMKFH QSTLPGNHDG  360
NVLQGMPMPF EINQQHIKGV SHLGDLSTGL DDSTMFPLST SLSDAKLTTN NNSSNALGVA  420
NNMMMLGHSQ DPQGGREFGN QSSVSLASLK SEFCPPLPDP GRCTDWSSSA QSSGFQSNTF  480
PLGDRYKQAT MHPGSLRDNN MPVMAPQIGG SQFDVSSFSS VSIRPHDSLT DAQCQTSAMN  540
NGALIQGWDN HKLDPSYRPN IMSSSMNSLM PVNAGAGGPL DQSLGLKNQV YHRSTDFNSM  600
GQPNYVDPLI AKYDEVEKST METLKLKHEY LMSQQRSQGG YISTNYGPLG DVVSAIMKQE  660
QDGRAEGDFD AYSLGTSI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A4e-27194257164ARR10-B
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1130135RRKKKD
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Could directly activate some type-A response regulators in response to cytokinins. Involved in the root-meristem size determination through the regulation of cell differentiation (PubMed:17363254). Involved in activating SHY2 during meristem growth and controls PIN expression via activation of SHY2 (PubMed:20605455). {ECO:0000250|UniProtKB:Q940D0, ECO:0000269|PubMed:17363254, ECO:0000269|PubMed:20605455}.
UniProtTranscriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010089952.10.0two-component response regulator ARR12 isoform X1
SwissprotP625981e-135ARR12_ARATH; Two-component response regulator ARR12
SwissprotQ6K8X61e-135ORR23_ORYSJ; Two-component response regulator ORR23
TrEMBLA0A2P5FN530.0A0A2P5FN53_TREOI; Two-component response regulator
STRINGXP_010089952.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF95634112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.11e-123response regulator 12
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Takahashi N, et al.
    Cytokinins control endocycle onset by promoting the expression of an APC/C activator in Arabidopsis roots.
    Curr. Biol., 2013. 23(18): p. 1812-7
    [PMID:24035544]
  3. Cortleven A, et al.
    A novel protective function for cytokinin in the light stress response is mediated by the Arabidopsis histidine kinase2 and Arabidopsis histidine kinase3 receptors.
    Plant Physiol., 2014. 164(3): p. 1470-83
    [PMID:24424319]
  4. Kim HJ,Kieber JJ,Schaller GE
    The rice F-box protein KISS ME DEADLY2 functions as a negative regulator of cytokinin signalling.
    Plant Signal Behav, 2013. 8(12): p. e26434
    [PMID:24675172]
  5. Choi SH, et al.
    Gene duplication of type-B ARR transcription factors systematically extends transcriptional regulatory structures in Arabidopsis.
    Sci Rep, 2014. 4: p. 7197
    [PMID:25425016]
  6. Jiang L, et al.
    Strigolactones spatially influence lateral root development through the cytokinin signaling network.
    J. Exp. Bot., 2016. 67(1): p. 379-89
    [PMID:26519957]
  7. Cortleven A, et al.
    Cytokinin Regulates the Etioplast-Chloroplast Transition through the Two-Component Signaling System and Activation of Chloroplast-Related Genes.
    Plant Physiol., 2016. 172(1): p. 464-78
    [PMID:27388681]
  8. Kobayashi K, et al.
    Shoot Removal Induces Chloroplast Development in Roots via Cytokinin Signaling.
    Plant Physiol., 2017. 173(4): p. 2340-2355
    [PMID:28193764]
  9. Zhang TQ, et al.
    A Two-Step Model for de Novo Activation of WUSCHEL during Plant Shoot Regeneration.
    Plant Cell, 2017. 29(5): p. 1073-1087
    [PMID:28389585]
  10. Meng WJ, et al.
    Type-B ARABIDOPSIS RESPONSE REGULATORs Specify the Shoot Stem Cell Niche by Dual Regulation of WUSCHEL.
    Plant Cell, 2017. 29(6): p. 1357-1372
    [PMID:28576846]
  11. Kobayashi K,Iwase A
    Simultaneous but spatially different regulation of non-photosynthetic callus formation and photosynthetic root development after shoot removal.
    Plant Signal Behav, 2017. 12(6): p. e1338999
    [PMID:28594268]
  12. Dai X, et al.
    ARR12 promotes de novo shoot regeneration in Arabidopsis thaliana via activation of WUSCHEL expression.
    J Integr Plant Biol, 2017. 59(10): p. 747-758
    [PMID:28681564]
  13. Zhang F,May A,Irish VF
    Type-B ARABIDOPSIS RESPONSE REGULATORs Directly Activate WUSCHEL.
    Trends Plant Sci., 2017. 22(10): p. 815-817
    [PMID:28886911]
  14. Yan Z, et al.
    Type B Response Regulators Act As Central Integrators in Transcriptional Control of the Auxin Biosynthesis Enzyme TAA1.
    Plant Physiol., 2017. 175(3): p. 1438-1454
    [PMID:28931628]
  15. Bustillo-AvendaƱo E, et al.
    Regulation of Hormonal Control, Cell Reprogramming, and Patterning during De Novo Root Organogenesis.
    Plant Physiol., 2018. 176(2): p. 1709-1727
    [PMID:29233938]