PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G034714.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family LBD
Protein Properties Length: 241aa    MW: 26463 Da    PI: 9.2684
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G034714.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260122.42.5e-3810108199
                DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89 
                           +CaaCk+lrrkC ++C++apyfp++qp+kfa vh+++G+ nv k+l+ ++  +re+a++sl+yeA+ar+rdPvyG++g+i+ l+++l++
  HL.SW.v1.0.G034714.1  10 PCAACKFLRRKCMPGCIFAPYFPSDQPQKFASVHRIYGTGNVAKILNGINAAHREEAVNSLAYEAQARLRDPVYGVIGFISILHNHLNH 98 
                           7**************************************************************************************** PP

                DUF260  90 lkaelallke 99 
                           ++a l+ + +
  HL.SW.v1.0.G034714.1  99 ARARLNNASN 108
                           ***9998776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.5859110IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-3710106IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MNIPPPPPPP CAACKFLRRK CMPGCIFAPY FPSDQPQKFA SVHRIYGTGN VAKILNGINA  60
AHREEAVNSL AYEAQARLRD PVYGVIGFIS ILHNHLNHAR ARLNNASNDL GGHTSPHPQP  120
QRIINPPPNG VPPMPNLKVN PNHQQQRQQL PQLRPFFFEN IPRPQHPQQQ MINNVTFDYM  180
GEGGPFGSMA NPDMMEHYNS QMLMAGSIFN RGGGRSSSVA ATDGACESNN NNTNLNGQLM  240
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A5e-401011011111LOB family transfactor Ramosa2.1
5ly0_B5e-401011011111LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtControls the proximal-distal patterning in petals and the adaxial-abaxial determination of leaves. Involved in the repression of the homeobox gene BP. {ECO:0000269|PubMed:12787254, ECO:0000269|PubMed:15821980}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009362272.14e-49PREDICTED: LOB domain-containing protein 36-like
RefseqXP_018504232.14e-49PREDICTED: LOB domain-containing protein 36-like
SwissprotQ9FKZ32e-41LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A2P5DEA82e-46A0A2P5DEA8_PARAD; Lateral organ boundaries domain containing protein
STRINGXP_009362272.12e-48(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.42e-42LBD family protein
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]
  2. Wang Z,Wang Y,Kohalmi SE,Amyot L,Hannoufa A
    SQUAMOSA PROMOTER BINDING PROTEIN-LIKE 2 controls floral organ development and plant fertility by activating ASYMMETRIC LEAVES 2 in Arabidopsis thaliana.
    Plant Mol. Biol., 2016. 92(6): p. 661-674
    [PMID:27605094]