PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G033935.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family Trihelix
Protein Properties Length: 325aa    MW: 38535.3 Da    PI: 7.7855
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G033935.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix81.11.5e-2563145186
              trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                           +W+ qe+++L+ +r e ++++ ++k++k lWe +s +m+e+gf+rsp+qCk+kw+nl +ryk ++++e +    +++++p++++++
  HL.SW.v1.0.G033935.1  63 QWSLQETKELLIIRAEFDQTFMETKRNKLLWEVISTRMKEKGFNRSPEQCKCKWKNLVTRYKGCETMEAEV---VRQQFPFYNEVQ 145
                           7********************************************************************96...67789***9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF819958.11E-7850No hitNo description
SMARTSM007170.003960122IPR001005SANT/Myb domain
CDDcd122031.22E-2462127No hitNo description
PfamPF138373.2E-1963147No hitNo description
PROSITE profilePS500907.61964120IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005730Cellular Componentnucleolus
GO:0016592Cellular Componentmediator complex
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MEGHHHHQNP HHHLHHQQQQ QQQQFHLQQQ QQQQQQHHPH QQQLQQNNPN ISVSVDVTDR  60
FPQWSLQETK ELLIIRAEFD QTFMETKRNK LLWEVISTRM KEKGFNRSPE QCKCKWKNLV  120
TRYKGCETME AEVVRQQFPF YNEVQAIFAA RTQMRMLWSD PEGAGMSGFS KKKGAMSSDD  180
EEDINNINDI DVISEGEQKG NIVSSSGINM RKKKKLMKSS SNNVGGTSGG IGSNNLREIL  240
EDFMKQQMAV ETQWREAFEA REEERRLKEM EWRQTMEALE SERLLMERRW REREEQRRIR  300
EEARAEKRDA LITALLNKLR REDL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ebi_A3e-1360143386DNA binding protein GT-1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010104264.11e-116Trihelix transcription factor GT-3b
SwissprotO804503e-75TGT3B_ARATH; Trihelix transcription factor GT-3b
TrEMBLW9RYU51e-115W9RYU5_9R
STRINGPOPTR_0006s10240.11e-105(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38250.13e-53Trihelix family protein