PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G033523.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family LBD
Protein Properties Length: 344aa    MW: 38455.9 Da    PI: 6.1792
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G033523.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260138.72e-4361051100
                DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89 
                           +CaaCk++rrkC+++Cv+apyfp +qp+kf nvhk+FGasnv+kll++l+ e+reda++sl+yeA+ar+rdPvyG+vg+i+ lqq+l+q
  HL.SW.v1.0.G033523.1   6 PCAACKIQRRKCTQECVFAPYFPPDQPQKFMNVHKVFGASNVSKLLQELSAENREDAVNSLAYEADARLRDPVYGCVGLISVLQQRLKQ 94 
                           7**************************************************************************************** PP

                DUF260  90 lkaelallkee 100
                           ++ +l ++k+e
  HL.SW.v1.0.G033523.1  95 VQYDLLSAKKE 105
                           ***99988876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.5685106IPR004883Lateral organ boundaries, LOB
PfamPF031951.5E-426102IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MQSNSPCAAC KIQRRKCTQE CVFAPYFPPD QPQKFMNVHK VFGASNVSKL LQELSAENRE  60
DAVNSLAYEA DARLRDPVYG CVGLISVLQQ RLKQVQYDLL SAKKELAAYL GPQSMVSIFQ  120
APIYMPHQGN PSSSSLYNNP YSSIMGAPGG GPLIIREPSQ VQPQAHVDAQ QIQAQIQAQI  180
QAQTQPHYLD AHQLAREHQQ DVLMRLTVEQ KMAIMQQQQQ QQPIQYQHRS VQQNLARFTT  240
GHDPRTGPDD ETAEFNEMGG SATAVGSGLV LGSGYQHPYD LVQQQDQQQS EHGHNPLQQL  300
HREEDQLLFD NPESPVLQLG PQTQLWHKFG NEDDRRNNIG PTS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-4531098114LOB family transfactor Ramosa2.1
5ly0_B3e-4531098114LOB family transfactor Ramosa2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018856691.11e-78PREDICTED: LOB domain-containing protein 36-like
TrEMBLA0A2P5ADH03e-97A0A2P5ADH0_PARAD; Lateral organ boundaries domain containing protein
TrEMBLA0A2P5FY723e-97A0A2P5FY72_TREOI; Lateral organ boundaries domain containing protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.13e-63ASYMMETRIC LEAVES 2-like 1