PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G032629.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family TALE
Protein Properties Length: 240aa    MW: 27523.1 Da    PI: 7.0718
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G032629.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox22.71.7e-071882212154
                           HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
              Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                           k +yp+++++++L +++gL+ +q+ +WF N+R +
  HL.SW.v1.0.G032629.1 188 KWPYPTEDDKAKLVEETGLQLKQINNWFINQRKR 221
                           468*****************************87 PP

2ELK25.92.3e-09142163122
                   ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                           ELK +L++++++++ ++++E++
  HL.SW.v1.0.G032629.1 142 ELKIELKQGFKSRIEDVREEIL 163
                           9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012567.7E-212681IPR005541KNOX2
PfamPF037911.1E-163080IPR005541KNOX2
PROSITE profilePS512139.132142162IPR005539ELK domain
PROSITE profilePS5007111.677162225IPR001356Homeobox domain
SMARTSM003891.4E-10164229IPR001356Homeobox domain
SuperFamilySSF466892.65E-16164229IPR009057Homeodomain-like
CDDcd000861.56E-11165226No hitNo description
Gene3DG3DSA:1.10.10.604.7E-25169227IPR009057Homeodomain-like
PfamPF059207.2E-18182221IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010089Biological Processxylem development
GO:0010192Biological Processmucilage biosynthetic process
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
QLPLIDAQLS QSHHLLRSYA SLAHSSNLSH HDRQDLDNFL AQYLIVLCTF KEQLQQHVRI  60
HAVEAVMACR EIENTLQALT GVSLGEGTGA TMSDDEDELV GQMDYCLDQS GGDNGNDMMM  120
MGFGPLLPTE SERSLMERVR HELKIELKQG FKSRIEDVRE EILRKRRAGK LPGDTTTVLK  180
NWWQQHSKWP YPTEDDKAKL VEETGLQLKQ INNWFINQRK RNWHSNSQSV TSLKSKRKR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A9e-13165221864Homeobox protein PKNOX1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1218238RKRNWHSNSQSVTSLKSKRKR
Functional Description ? help Back to Top
Source Description
UniProtPossible developmental regulator.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By wounding; up to 7-fold increase.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010108056.11e-155homeobox protein HD1
SwissprotP466061e-142HD1_BRANA; Homeobox protein HD1
TrEMBLA0A2P5CSP51e-162A0A2P5CSP5_TREOI; Knotted-like homeobox transcription factor
STRINGXP_010108056.11e-155(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF63483450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G62990.11e-133KNOTTED-like homeobox of Arabidopsis thaliana 7
Publications ? help Back to Top
  1. Boivin R,Hamel F,Beauseigle D,Bellemare G
    Stage-specific transcription of the homebox gene Bnhd1 in young tissues and flowers of Brassica napus.
    Biochim. Biophys. Acta, 1994. 1219(1): p. 201-4
    [PMID:7916213]