PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G031956.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family SBP
Protein Properties Length: 1051aa    MW: 116325 Da    PI: 8.5596
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G031956.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.21.6e-40134211178
                           --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                   SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                           +Cqv++C++dls ak+yhrrhkvCe hsk++++lv+ ++qrfCqqCsrfh lsefDe+krsCrrrLa+hn+rrrk+q+
  HL.SW.v1.0.G031956.1 134 MCQVDNCKEDLSAAKDYHRRHKVCELHSKSTKALVASQMQRFCQQCSRFHPLSEFDEGKRSCRRRLAGHNRRRRKTQP 211
                           6**************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.6E-33129196IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.778132209IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.62E-37133213IPR004333Transcription factor, SBP-box
PfamPF031102.1E-29135208IPR004333Transcription factor, SBP-box
SuperFamilySSF484036.13E-6810949IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.200.001810948IPR020683Ankyrin repeat-containing domain
CDDcd002041.79E-4853952No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1051 aa     Download sequence    Send to blast
MEEAGAQVAP PIFIHRTLSV MGKKRDLPYQ TPNFQQRFSN PNPVGNWNPK VWDWDTVRFL  60
AKPLDSGAAT INADHTKAEE PPVTPLTLTN KTPEVTDATL RLNLGGGFTS GDDPGSRPNK  120
RVRSGSPGST TYPMCQVDNC KEDLSAAKDY HRRHKVCELH SKSTKALVAS QMQRFCQQCS  180
RFHPLSEFDE GKRSCRRRLA GHNRRRRKTQ PDDVGSRLVL PGDRDNKING HLDIFNLLAA  240
VARAQGKNDD KNMNCSPILD KEQLVQILSK INSLPLPMDL AAKLHNLASL SRKIPDQTST  300
DHHDKLNGRA SQSTMDLLAA LSATLAPSAP DALATLSQRS SPSSDSGKTK LNCHDQANSS  360
VLQKRSPQEF PSLGGDRSST SYQSPMEDSD CQVQETRVNL PLQLFSSSPE NDSPPKLASS  420
RKYFSSDSSN PIEERSPSSS PPVMQTLFPM QTMAETVKSE KMSASRETNA NVESSRINGC  480
NMPFDLFRGS NRATEAGSIQ SVPHQAGYTS SGSDHSPSSL NSDVQDRTGR ILFKLFDKDP  540
SHFPGTLRTQ IFNWLSNSPS EMESYIRPGC VVLSVYVSMP SAAWEQLQEN LLQRLSSLVH  600
SSASDFWRNG RFLVHAGRQL ASHKDGKFRL CKSWKTWSSP ELISVTPLAV VGGQETSLIL  660
RGRNLNNLGT KIHCTDKGVY TTMEVRASTY QGTMYEEINL CGFRTHDASP SLFGRCFIEV  720
ENGFKGNSFP VIIADASICK ELRVLESVFY GEKKVSEVIA EDENHDDGRP RSKDEVLHFL  780
NELGWLFQRK KASSLLNGPH YSLGRFKFLL TFSVERNCSS LIKTLLDILV ERNMDENELS  840
REAVEMLSEV QLLHRAVKSK CKKMVDLLIN YSVIGSNDVS KKYIFQPNHV GPGYITPLHL  900
AACMSSSDEM IDALTNDPQE IGLNSWNSLL DANGQSPHAY ALMTNNQSYN KLVARKLGDR  960
TNGQITVTVG NAMSVEYQHG SRRSCAKCAV AATKYKRRVP GSQGLLQRPY VHSMLAIAAV  1020
CVCVCLFLRG LPDIGAVAPF KWENLDYGTI *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A7e-32125208184squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May play a role in plant development. {ECO:0000250, ECO:0000269|PubMed:15703061}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00155DAPTransfer from AT1G20980Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010094493.10.0squamosa promoter-binding-like protein 14
SwissprotQ8RY950.0SPL14_ARATH; Squamosa promoter-binding-like protein 14
TrEMBLA0A2P5DIW90.0A0A2P5DIW9_TREOI; SBP-box transcription factor
STRINGXP_010094493.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96943139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.10.0squamosa promoter binding protein-like 14
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Liu J, et al.
    Characterizing Variation of Branch Angle and Genome-Wide Association Mapping in Rapeseed (Brassica napus L.).
    Front Plant Sci, 2016. 7: p. 21
    [PMID:26870051]