PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G031526.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family bZIP
Protein Properties Length: 104aa    MW: 11791.5 Da    PI: 10.453
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G031526.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.13.9e-131541063
                          HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                bZIP_1 10 kqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                          +++NRe+ArrsR R+k++ieeL+  v +L++ N++L ++l +l +  ++  +e+
  HL.SW.v1.0.G031526.1  1 MISNRESARRSRMRRKMQIEELQYLVSQLQTTNRQLSEKLIQLLDSNQQIVQEN 54
                          689****************************************99999988877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd147027.84E-10144No hitNo description
PfamPF001703.5E-11153IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.358157IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.63E-9148No hitNo description
SMARTSM003382.0E-5156IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.2E-10250No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 104 aa     Download sequence    Send to blast
MISNRESARR SRMRRKMQIE ELQYLVSQLQ TTNRQLSEKL IQLLDSNQQI VQENSQLKEK  60
VSSLQIILSD LLVPVRNIVG EDTRAQLAST TPSATVSSMQ LLH*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010087331.23e-52basic leucine zipper 43
TrEMBLW9QY744e-50W9QY74_9ROSA; G-box-binding factor 1
STRINGXP_010087331.16e-51(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130442430
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60830.14e-20basic leucine-zipper 70