PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G031283.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family HD-ZIP
Protein Properties Length: 789aa    MW: 86276.4 Da    PI: 6.374
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G031283.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox64.51.5e-2081136156
                           TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
              Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                           ++k +++t++q++eLe++F+++++p++++r eL+++l+L+++qVk+WFqNrR+++k
  HL.SW.v1.0.G031283.1  81 KKKYHRHTPNQIQELESFFKECPHPDEKQRLELSRRLSLETKQVKFWFQNRRTQMK 136
                           79999************************************************999 PP

2START194.64.8e-612925162206
                           HHHHHHHHHHHHHHHC-TT-EEEE.....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S... CS
                 START   2 laeeaaqelvkkalaeepgWvkss.....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla... 77 
                           la++a++el+k+a+ae p+W kss     e++n +e++++f++  +     + +ea r+s vv+ ++  lve+l+d + +W e+++   
  HL.SW.v1.0.G031283.1 292 LALAAMDELLKLAQAEGPMWIKSSnggskEMLNHEEYMRTFPPCIGakpngYVSEATRDSSVVIINSLALVETLMDAN-RWVEMFPcli 379
                           6899***************************************99999******************************.********** PP

                           .EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEEC CS
                 START  78 .kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepks 158
                            +a+t+e+is g      galq m aelq+lsplvp R   f+R+++q+g+g+w++vdvS+d +++  +  s+  +++lpSg+l+++++
  HL.SW.v1.0.G031283.1 380 sRASTIETISAGmggtrnGALQAMHAELQVLSPLVPlRPLKFIRFCKQHGEGVWAVVDVSIDINREALNADSYFQCRRLPSGCLVQDMP 468
                           ******************************************************************988******************** PP

                           TCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                 START 159 nghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                           +g+skvtwveh +++++ +h+++rs ++sg+ +ga++w+atlqrqce+
  HL.SW.v1.0.G031283.1 469 DGYSKVTWVEHSEYDASGVHQMFRSYISSGMGFGAQRWLATLQRQCEC 516
                           **********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.67E-2067138IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-2167138IPR009057Homeodomain-like
PROSITE profilePS5007117.52478138IPR001356Homeobox domain
SMARTSM003894.9E-1880142IPR001356Homeobox domain
CDDcd000863.15E-1981138No hitNo description
PfamPF000463.5E-1881136IPR001356Homeobox domain
PROSITE patternPS000270113136IPR017970Homeobox, conserved site
PROSITE profilePS5084843.422282519IPR002913START domain
SuperFamilySSF559612.56E-33283517No hitNo description
CDDcd088756.40E-117286515No hitNo description
SMARTSM002343.0E-50291516IPR002913START domain
PfamPF018527.3E-53292516IPR002913START domain
SuperFamilySSF559617.8E-20544780No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 789 aa     Download sequence    Send to blast
MPHRAIARPY FVSPSIMPNS LKTSSRKMDN HGEMGLLGEN FDLGMIGRIR DDGYESRSGS  60
DNLEGASGDD QDAGDDQPPR KKKYHRHTPN QIQELESFFK ECPHPDEKQR LELSRRLSLE  120
TKQVKFWFQN RRTQMKTQLE RHENIILRQE NDKLRAENNM IKDAMSNPMC NQCGGPAIPG  180
QISFEEHQLR IENARLKDEL SRICSLANKF LGRPLSSLVA PLPLPSSAGL ELAVGRNGMG  240
GLNAIGPPLP MGLDLGDGVS SSAHMMPLVK SSMGMNVFGN EIPFERSMFI DLALAAMDEL  300
LKLAQAEGPM WIKSSNGGSK EMLNHEEYMR TFPPCIGAKP NGYVSEATRD SSVVIINSLA  360
LVETLMDANR WVEMFPCLIS RASTIETISA GMGGTRNGAL QAMHAELQVL SPLVPLRPLK  420
FIRFCKQHGE GVWAVVDVSI DINREALNAD SYFQCRRLPS GCLVQDMPDG YSKVTWVEHS  480
EYDASGVHQM FRSYISSGMG FGAQRWLATL QRQCECLATL MSPSIPNEDQ IAVSSGGRRS  540
LLKLAKRMVD NFCAGVCAST VRKWDKLRVD NVGEDVRVMT RKSMDDPGEP PGIILSAATS  600
VWIPVSQKRL FEFLRDEQLR SEWDILSNGG PMQEMVHITK GQRHGNHVSL LRAGSIGAND  660
STMLILQETW TDASGSMVVY APVDSAAINV VMHGGDSAYV ALLPSGFAIV PDGTSQSGYV  720
SGNNESSSLA LVKGEGDDSG GCILTVGFQI LVNSLPSAKL TVESVETVNN LISCTIQKIK  780
AALSGPSA*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024028635.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X2
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A2P5CZI40.0A0A2P5CZI4_TREOI; Octamer-binding transcription factor
STRINGXP_010107411.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]