PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G030891.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family LBD
Protein Properties Length: 209aa    MW: 23421.2 Da    PI: 7.3325
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G030891.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260146.29.5e-46231221100
                DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89 
                           +CaaCk+lrr+Ca+dCv+apyfpa++p+kfa vhk+FGasnv k+l++lpe++r+da+ss+vyeA+ar+rdPvyG+vg i++lqqq++ 
  HL.SW.v1.0.G030891.1  23 PCAACKLLRRRCAQDCVFAPYFPADEPQKFASVHKVFGASNVNKMLQELPEDQRSDAVSSMVYEANARVRDPVYGCVGAISSLQQQIDA 111
                           7**************************************************************************************** PP

                DUF260  90 lkaelallkee 100
                           l+++lal+++e
  HL.SW.v1.0.G030891.1 112 LQTQLALAQAE 122
                           ******99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.23922123IPR004883Lateral organ boundaries, LOB
PfamPF031953.5E-4523120IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 209 aa     Download sequence    Send to blast
MGSYLEIYII MKESGRKQGA MSPCAACKLL RRRCAQDCVF APYFPADEPQ KFASVHKVFG  60
ASNVNKMLQE LPEDQRSDAV SSMVYEANAR VRDPVYGCVG AISSLQQQID ALQTQLALAQ  120
AEVVHMRMSQ FSPTPNHNNN PHQSTDSITT HHHHHPSTDQ NNNNNKHHIM SNTTSHHHHL  180
HHQTKSFFSL DMAVDHHQAN MGESLWSC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-49191367124LOB family transfactor Ramosa2.1
5ly0_B1e-49191367124LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007212145.11e-95LOB domain-containing protein 4
RefseqXP_008226099.11e-95PREDICTED: LOB domain-containing protein 4
RefseqXP_021828556.11e-95LOB domain-containing protein 4-like
SwissprotQ9SHE92e-68LBD4_ARATH; LOB domain-containing protein 4
TrEMBLA0A2P5CCR01e-99A0A2P5CCR0_TREOI; Lateral organ boundaries domain containing protein
STRINGXP_008226099.14e-95(Prunus mume)
STRINGEMJ133444e-95(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF133434105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.18e-64LOB domain-containing protein 4