PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G029269.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family HB-other
Protein Properties Length: 940aa    MW: 105110 Da    PI: 9.5979
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G029269.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox15.53.1e-0569125157
                           TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
              Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                           +r+R  ++++ ++ ++++F  +  +s++e +e+ +  g+t +qV+ +F  +R + ++
  HL.SW.v1.0.G029269.1  69 KRPRDLLNPKAVKYMQSVFSVKDAVSKKECREICALYGVTVTQVREFFASQRSRVRR 125
                           799**************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500718.98966126IPR001356Homeobox domain
SuperFamilySSF466891.11E-668133IPR009057Homeodomain-like
SMARTSM003890.001668130IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.6E-569136IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 940 aa     Download sequence    Send to blast
MKVSKENFLE LQIGTSAESL QKSLGSQREL FHSQIDQLQR IVVTQCRLTG ANPLSQEMAA  60
GALSIKIGKR PRDLLNPKAV KYMQSVFSVK DAVSKKECRE ICALYGVTVT QVREFFASQR  120
SRVRRLVRLS RENATKSNSC AELNDGVHAS SDLLLPIQPV PLNTIGPTSV EETPPCSTKD  180
DVLPGIDDLD KQFVENIFSL MRKEETYSGQ VKLMEWILQI KNSAVLYWFL CKGGMMILAT  240
WLSQAAEEEQ TSILFVILNV LCHLPLHKAL PVHMSAILQS VNRLRFYRTS EFRERRKVQL  300
VEQPGQRAAG RSPQTTRAGP LNQGRPMSAD DIQKAKLRAQ YMQSKYVKAN SSCENKAAKT  360
EALNKPSTSQ VSNVSTASKV LVRPSMEEHK KPTITPLKVP NTLEASLESK PRTDLKESAW  420
EKCSRVQNLW QTPPEVKLSQ QWRVGTGDNS KEAEFQKNRN RREKETFYQT NQEIPLNPKE  480
PWDREMDYDD SLTPEIPIEQ LPEPNGGSNA EAHVSPKHGV DSAVTQIVAS QRAVGSVPLP  540
PDTSQSGNAS TAEPDLELLA VLLKNPELVF ALTSGQAANL SSEETVKLLD MIKAGNATSN  600
NGINRQVEEK VEVSLPSPTP STNPGTVRHF GLFAGYHNHS QFFTGTAKLI LLYFIMSGWR  660
PEGVRNPFSR VPLPKRVAES PPAVATAKSV LPSHMLAPHN PPVMSSYSLS QVTSMVHEKY  720
SPLGSSLHQP PLTSSPIVHT NLPPATGPMY NLHPQDVSSL RLESATNIKP QASMSNNMYN  780
VEERRHHSFP TPLPVAPSRL MLPHMHQQQY QPQQQQQHYA EPSPSVPMYS KQIGKSSNAP  840
DSWRPQQNLP SNYNPIVNQN NSNYHRGLYV EEDEFESWSP DNSPSRNSEY GGLGRSFPEP  900
RMDSGRGYRP TDQSRVRSSP GYRDSNRHGN RRWRDQRRR*
Functional Description ? help Back to Top
Source Description
UniProtSeems to play a role in the regulation of flowering time in the autonomous flowering pathway by repressing FLOWERING LOCUS C expression. {ECO:0000269|PubMed:10363371}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024017708.10.0homeobox protein LUMINIDEPENDENS
SwissprotQ387961e-120LUMI_ARATH; Homeobox protein LUMINIDEPENDENS
TrEMBLA0A2P5FFR50.0A0A2P5FFR5_TREOI; Octamer-binding transcription factor
STRINGEOX949881e-163(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF98092934
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.21e-115HB-other family protein
Publications ? help Back to Top
  1. Chakrabortee S, et al.
    Luminidependens (LD) is an Arabidopsis protein with prion behavior.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(21): p. 6065-70
    [PMID:27114519]