PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G026792.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family LBD
Protein Properties Length: 179aa    MW: 18994.5 Da    PI: 8.1352
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G026792.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260145.91.2e-45211201100
                DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89 
                           +CaaCk+lrr+Ca+dCv+apyfpa++p+kfanvhk+FGasnv k+l++lp ++r da+ss+vyeA+ar+rdPvyG+vg i++lqqq++ 
  HL.SW.v1.0.G026792.1  21 PCAACKLLRRRCAQDCVFAPYFPADEPQKFANVHKVFGASNVNKMLQELPVHHRGDAVSSMVYEANARVRDPVYGCVGAISSLQQQIDV 109
                           7**************************************************************************************** PP

                DUF260  90 lkaelallkee 100
                           l+a+lal+++e
  HL.SW.v1.0.G026792.1 110 LQAQLALAQAE 120
                           ******99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.16220121IPR004883Lateral organ boundaries, LOB
PfamPF031953.4E-4521118IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 179 aa     Download sequence    Send to blast
MKDTSSSGGG GGGRKQGAPS PCAACKLLRR RCAQDCVFAP YFPADEPQKF ANVHKVFGAS  60
NVNKMLQELP VHHRGDAVSS MVYEANARVR DPVYGCVGAI SSLQQQIDVL QAQLALAQAE  120
VVHLRVRQNA SLSSHGLSPA SPSNSDSPSS KLMGSQPKPI FEMDMSVDQG SFGETMWC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-49171227112LOB family transfactor Ramosa2.1
5ly0_B2e-49171227112LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022777251.11e-105LOB domain-containing protein 4 isoform X1
SwissprotQ9SHE91e-76LBD4_ARATH; LOB domain-containing protein 4
TrEMBLA0A314YWZ31e-104A0A314YWZ3_PRUYE; LOB domain-containing protein 4
STRINGXP_009353911.11e-103(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF133434105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.14e-71LOB domain-containing protein 4