PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G026753.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family GRF
Protein Properties Length: 200aa    MW: 22260 Da    PI: 9.6965
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G026753.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC74.41.2e-23103146144
                   WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                           d+ep+rCrRtDGKkWRCs+++l+ +k+CErH+hrgr+rsrk ++
  HL.SW.v1.0.G026753.1 103 DNEPWRCRRTDGKKWRCSKEALPHQKYCERHIHRGRHRSRKLVD 146
                           68***************************************987 PP

2QLQ38.63.4e-144174336
                   QLQ  3 FTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                          FT  Ql++L  Q l+yKy+ a++PvP +L+q+i+
  HL.SW.v1.0.G026753.1 41 FTILQLHELQLQTLIYKYIEAGLPVPYNLVQPIW 74
                          7778*****************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.9E-43975IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166618.6454075IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.4E-114174IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.417103147IPR014977WRC domain
PfamPF088794.0E-20105145IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 200 aa     Download sequence    Send to blast
MAHFTSSGFG QEEGSSQIGL NLELGRGVCQ NKRSSSSYHG FTILQLHELQ LQTLIYKYIE  60
AGLPVPYNLV QPIWQSFSSS ITGLNNGLGV VGPLYLDSRK GMDNEPWRCR RTDGKKWRCS  120
KEALPHQKYC ERHIHRGRHR SRKLVDSCNS KTTTMANTST SNNGGGGIGS TMTDLSISLH  180
VNENNTRGFL FPRLDFQPN*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015881992.12e-57PREDICTED: growth-regulating factor 10-like
SwissprotQ6EPP93e-39GRF10_ORYSJ; Growth-regulating factor 10
TrEMBLF6HUK81e-55F6HUK8_VITVI; Putative uncharacterized protein
STRINGVIT_02s0025g04910.t013e-55(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF141951017
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.13e-29growth-regulating factor 2