PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G026311.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family LBD
Protein Properties Length: 323aa    MW: 36991.9 Da    PI: 5.8862
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G026311.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260127.75.2e-40101091100
                DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89 
                           aCaaCk++rrkC+++C+lap fp+++p++f+ +h+lFG++n+l++lk +++ +r+dam+s++ye+++r + Pv+G+vg+i+ lq q++q
  HL.SW.v1.0.G026311.1  10 ACAACKYQRRKCSRECPLAPFFPSDRPQRFQHAHRLFGVRNILNILKVVSPCQRQDAMTSIIYESDMRKQFPVQGCVGIINLLQTQIDQ 98 
                           7**************************************************************************************** PP

                DUF260  90 lkaelallkee 100
                           +++e+++++++
  HL.SW.v1.0.G026311.1  99 MQEEIHAIQSK 109
                           ******99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.4069110IPR004883Lateral organ boundaries, LOB
PfamPF031951.0E-3710107IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009556Biological Processmicrosporogenesis
GO:0009786Biological Processregulation of asymmetric cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MTIKGGTTQA CAACKYQRRK CSRECPLAPF FPSDRPQRFQ HAHRLFGVRN ILNILKVVSP  60
CQRQDAMTSI IYESDMRKQF PVQGCVGIIN LLQTQIDQMQ EEIHAIQSKI LLFKQQQQHQ  120
QQIIPFSSST PDDDHHHYNN LQLATTTVTS NDHNTVLDQL QHVHIDHDHH HNQYNDTTPT  180
GVYFSNYDFL TEENDKVDGV STGIDGTDLD HNNQDPGHNK EMMKMHQHYH QQSDLINPSS  240
LIDMNEIAPP AHLRPTLFFV PSPQDQHDQE EVDLCYDDQC TAAFDNIVDD RQSFIESKGP  300
CESSAESSMK HATQYVKNEH NY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-2861137114LOB family transfactor Ramosa2.1
5ly0_B1e-2861137114LOB family transfactor Ramosa2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44152958
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.12e-39LOB domain-containing protein 27