PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G025494.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family SBP
Protein Properties Length: 576aa    MW: 64654.8 Da    PI: 7.6909
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G025494.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.75.3e-41230305277
                           -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                   SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                           Cqv+gC++dls+ k+yh++hkvC+vhsk+++v+++g+eqrfCqqCsrfh l efD++krsCrrrL +hnerrrk+q
  HL.SW.v1.0.G025494.1 230 CQVHGCNMDLSTSKDYHKKHKVCDVHSKTSKVILNGIEQRFCQQCSRFHLLAEFDDGKRSCRRRLVGHNERRRKPQ 305
                           **************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.3E-33224291IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.188227304IPR004333Transcription factor, SBP-box
SuperFamilySSF1036127.59E-39228308IPR004333Transcription factor, SBP-box
PfamPF031107.5E-31230303IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010468Biological Processregulation of gene expression
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 576 aa     Download sequence    Send to blast
MRFSLPIFIF FFKRSFVLCF KFNSFRVTLR FSFSNFLVAR RVLSLISLAS ATWDSDHTSM  60
VSWNFASEGK ALLFSDDIDW SDAFSRNRKA LIQCENGLVP GRESVESLEY MELGFPEMLR  120
KTFQSSQGLE MLCGGEVGND SFHRAASPAC LISPNSSLVE DESGSNSKVS SSFMEFNSQD  180
SPLIALKLGR FGDCRNSQNS EHPKDKTVST PSLVVKRARI RGSYSQTPFC QVHGCNMDLS  240
TSKDYHKKHK VCDVHSKTSK VILNGIEQRF CQQCSRFHLL AEFDDGKRSC RRRLVGHNER  300
RRKPQLDGLS DKPHKFSHAY QGTRYPGTSL QKRTPFVFSD ILPGVILSPE KFEQANPFGH  360
IKFEEEPIYS PQLTVPVKNA QMFSTSLIHP HSSGVPSSET EDYCFHTAAT IHKTSGASNS  420
ACALSLLSAH SHNFSSHSAG IPNESPMTIQ GSHQTISQLS EKPLRLRSME RHGSNGFYSC  480
GMNPIGVDQF EPTVFTETSQ TADFEVPADR SFQNSNCLDT KYSLSLEHES TVDLLQLSSH  540
LQRVEHQRNF MPVKQENEDF CCKVEIVCGL HHQIS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-292293031084squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150438e-39AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015895206.10.0squamosa promoter-binding-like protein 6
TrEMBLA0A2P5FHG10.0A0A2P5FHG1_TREOI; SBP-box transcription factor
STRINGXP_010091609.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.12e-45SBP family protein