PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G024312.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family TCP
Protein Properties Length: 90aa    MW: 9331.6 Da    PI: 4.6881
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G024312.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP52.61.9e-161572480
                   TCP 24 lsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaessss 80
                          ++a c a++F+L  eLG+ +d + i WLl  a+p+i ++tg+++s+++ +++ ss++
  HL.SW.v1.0.G024312.1  1 MPAMCTAQIFQLSCELGHWSDDESIKWLLDHAQPSIVAATGSGTSPSRPVSTTSSVV 57
                          9*********************************************97775555554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136912.941139IPR017887Transcription factor TCP subgroup
PfamPF036342.2E-10155IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 90 aa     Download sequence    Send to blast
MPAMCTAQIF QLSCELGHWS DDESIKWLLD HAQPSIVAAT GSGTSPSRPV STTSSVVPAY  60
APTNMVQPVS PMGGQGLFTM TAPPSCHLD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022143970.14e-27transcription factor TCP11
RefseqXP_023518605.14e-27transcription factor TCP11-like
SwissprotO646471e-15TCP9_ARATH; Transcription factor TCP9
TrEMBLA0A067JZ182e-25A0A067JZ18_JATCU; Uncharacterized protein
STRINGcassava4.1_029119m2e-25(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38193363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45680.13e-14TCP family protein