PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G021591.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family SBP
Protein Properties Length: 463aa    MW: 50523.1 Da    PI: 7.53
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G021591.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP127.35.9e-40203279278
                           -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                   SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                           CqvegC++ l +ak+yhrrhkvCe+hskap+v+vsgleqrfCqqCsrfh +sef+e+krsC+rrLa+hnerrrk+++
  HL.SW.v1.0.G021591.1 203 CQVEGCHVALVNAKDYHRRHKVCEMHSKAPKVMVSGLEQRFCQQCSRFHVVSEFEESKRSCKRRLAGHNERRRKSSH 279
                           **************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.107.6E-31198264IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.787200277IPR004333Transcription factor, SBP-box
SuperFamilySSF1036128.24E-38201282IPR004333Transcription factor, SBP-box
PfamPF031101.8E-31203276IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 463 aa     Download sequence    Send to blast
MDIRESNTLG NRAQGVNINI GSTGTLAWNI WELSNSASRM DWTTTSPTHT TGFYANSAAS  60
GEAEEVPNSG SRSHGFGPSD ELLMPRGYGH QQGTTAEGGH GFMQQHHGHQ SLYNAVGDGI  120
HLHPDPHLVC LKLGKRHYFE DTSGSATATT GPMGERGVMG FPLGIKRGKA LYGSGGVVAT  180
AAESLLPVTV PKCQVEGCHV ALCQVEGCHV ALVNAKDYHR RHKVCEMHSK APKVMVSGLE  240
QRFCQQCSRF HVVSEFEESK RSCKRRLAGH NERRRKSSHD SIARHSSHHE NNKVVVGGGF  300
PYMAASTTGR ALSLLSSKTP DYSWVPPSES DLSSRSSAAL RELIAENRAA ILARQLVVDR  360
DAWPSHHHHH HPSDHVFGSE ASAPRGFGSV ESHHHHNMFP EPNQSGGWER ISENCTHVTL  420
DLMQAPSQEF GTFMASRGKT KAEEDNCSDH HLWNSFQGHN LV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A9e-31200276884squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1259266KRSCKRRL
2263274KRRLAGHNERRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024032956.11e-133squamosa promoter-binding-like protein 7
TrEMBLA0A2P5C9H50.0A0A2P5C9H5_TREOI; SBP-box transcription factor
STRINGXP_010089257.11e-143(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96132738
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G27370.45e-36squamosa promoter binding protein-like 10