PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G019779.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family TCP
Protein Properties Length: 194aa    MW: 20999.8 Da    PI: 7.6852
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G019779.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP108.88.2e-3483154273
                   TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73 
                            +k+ +++++h kv+gR+RR+R++a caar+F+L++eLG+++d++ti WLl+ a+pai+++tgt++ +a ++
  HL.SW.v1.0.G019779.1  83 VAKRASTKDRHRKVEGRGRRIRIPAACAARIFQLTRELGHKSDGETIRWLLEHAEPAIIAATGTGTVPAIAM 154
                           5799************************************************************98888444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036344.4E-2888160IPR005333Transcription factor, TCP
PROSITE profilePS5136925.55389143IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 194 aa     Download sequence    Send to blast
MAMIQNHEVQ EEKGRKVAEL KINGGGEAEQ NDVVAEEQTN QTLSLNEAAP TSSSVEPKEE  60
PEERSSADAL QLVPLAVQVT GPVAKRASTK DRHRKVEGRG RRIRIPAACA ARIFQLTREL  120
GHKSDGETIR WLLEHAEPAI IAATGTGTVP AIAMSVNGTL KIPTATPDPE PDDPILKKKR  180
KRPPFQSQPG WLL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1175182LKKKRKRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015899326.18e-67transcription factor TCP9
SwissprotO646472e-55TCP9_ARATH; Transcription factor TCP9
TrEMBLA0A2P5AXE13e-75A0A2P5AXE1_PARAD; TCP transcription factor
STRINGevm.model.supercontig_18.1765e-63(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF21183086
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45680.11e-44TCP family protein