PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G016220.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family GRF
Protein Properties Length: 632aa    MW: 67656.2 Da    PI: 7.4038
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G016220.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC77.21.7e-24243286144
                   WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                           daepgrC+RtDGKkWRCsr+v +++k+CErH+hrgr rsrk++e
  HL.SW.v1.0.G016220.1 243 DAEPGRCKRTDGKKWRCSRDVAPDQKYCERHMHRGRPRSRKHVE 286
                           79****************************************98 PP

2QLQ491.8e-17182214234
                   QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqa 34 
                           +FT+aQl +L++Q++++Ky++a++PvP +Ll++
  HL.SW.v1.0.G016220.1 182 PFTNAQLKELERQAMIFKYMVASVPVPLDLLLP 214
                           8*****************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009513.3E-9181217IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.0E-11182214IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166619.442182217IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.126243287IPR014977WRC domain
PfamPF088793.8E-20244286IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010114Biological Processresponse to red light
GO:0010218Biological Processresponse to far red light
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 632 aa     Download sequence    Send to blast
MDNFGVSDKK EEAIENNNNN NNTNIKACTN SSHVLGLGVE LQSRESLPNK SMRMMMMTKM  60
MMLDHHQTQA NHNRLFQSSQ IGVSDGPTTT TAPTNSNSTT TPTPTPKAND YNNIYGLVGS  120
SPVVFGFGGG AAVKTPLQQP FNTCCSSSSI TTTATPAAAA PVSYTTALRS PGGVMAASVG  180
FPFTNAQLKE LERQAMIFKY MVASVPVPLD LLLPFNRTTI GSAIPIHYPF GGEYKLRFSN  240
GTDAEPGRCK RTDGKKWRCS RDVAPDQKYC ERHMHRGRPR SRKHVEVQVN NNIHNNNNSN  300
SSKRTRHDNQ QQTLLASSSA SLATSTVTNP QCHQSHFLGS STTALPYHPS PFFMDKPVFE  360
SMPSLSADKE ARSMEWMMKG EAVTMAASDP RWLHLMQSKM ELPSKSSFCD NNSSSIFSQQ  420
EEPFLNLNSY GSFGTGEVEQ DRECALFLNP EDVSLDHQQT NSDTPRSFID AWSKTNMGET  480
MAHSCSSVNQ SSVSSQGKLS PSSLTLSMGG YGSMNDEMGR TQIGSGFNGS DDTKPHVSSW  540
LTPASWATAA SPPGGPLAEV LRSSSLTATT SAASDPSSPF PGNGDSGSPP ATAVSSPSGV  600
LQKTVTSLSD SSGCSSPGLG SSKVKAEIAL L*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021805463.11e-170growth-regulating factor 7 isoform X1
TrEMBLA0A2P5E6L60.0A0A2P5E6L6_TREOI; Growth-regulating factor
STRINGXP_008234659.11e-163(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF73242842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.12e-37growth-regulating factor 7