PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G015009.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family G2-like
Protein Properties Length: 488aa    MW: 52633.3 Da    PI: 7.6664
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G015009.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.64.9e-32298351255
               G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                           pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  HL.SW.v1.0.G015009.1 298 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 351
                           9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.05E-15295351IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-28296351IPR009057Homeodomain-like
TIGRFAMsTIGR015571.3E-23298351IPR006447Myb domain, plants
PfamPF002499.3E-7299350IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 488 aa     Download sequence    Send to blast
MPLEGIFIEA ASSTAAAVLP DLSLNISPPN TTSTCSSSAA AAALDDARFD LDLSCRRRES  60
DNHNSSTTCS SSSTATNTSK AHTDLSLGRL SLMSSASTLN GAGDPPPNPY QQHNPHPHHL  120
YNHTMNRGSG GGGGLSLLDV SADAFRPIKG IPVYHNRSFP FLSADNTRVV DHVKDPKMCF  180
YQMAPSLSGA AATPYFGGRG GGVLDPMSML SSPGLPNGSS VAAVAAYRAA RLNGLAAAAE  240
AYKSANNQLH HHHQLHQHHH HHLHHHNNQY GQTEISSHGT MRARFLPKLP TKRSMRAPRM  300
RWTSTLHARF VHAVELLGGH ERATPKSVLE LMDVKDLTLA HVKSHLQMYR TVKTTDKPAA  360
SSGQSDGSGE DEMSQMGMSG SDSTGGLRTQ YVDQRGPSDR SNLQPDQMDF QSSLWSNSSS  420
GREVWSSRNN SGDIDGLPLQ SSVISQQIQE CESTRVKSYV ENKNNFEGKN PSLEFTLGRP  480
GWQGEEI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-16299353357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-16299353357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-16299353357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-16299353357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024024392.11e-167transcription repressor KAN1 isoform X2
TrEMBLA0A2P5FZU70.0A0A2P5FZU7_TREOI; KANADI transcription factor
STRINGXP_010101071.11e-165(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.13e-61G2-like family protein