PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G014952.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family GRAS
Protein Properties Length: 488aa    MW: 54467.2 Da    PI: 5.7224
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G014952.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS287.34.2e-88604802373
                  GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn.....sseelaal.... 81 
                           ++lL++cA+a++s+d +laq++L+ l+++a p+gd++qRl++ f++AL +r ar ++++ k l++   ++        +++l+++    
  HL.SW.v1.0.G014952.1  60 EQLLVHCANAIESNDVTLAQQILWVLNNIAQPEGDSNQRLTSAFLRALITRAARIGTSCIKMLASAVVARPLllqnqDDDNLNVVfnvp 148
                           79****************************************************99999888855544433223333344444446777 PP

                  GRAS  82 ........klfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesg......sk 155
                                    +f +++P+++f++ +aN aIleaveg + +H +D++ ++++Q p+L +a+asR+ e +p +++T+v+++e++        
  HL.SW.v1.0.G014952.1 149 hrfsvidfATFIDLTPWHRFGFTAANAAILEAVEGFSVIHLVDLSSTHCMQIPTLVDAIASRNyEVTPIIKLTVVVAAEANdvvppiLD 237
                           7777776677*****************************************************8889*********9888889998888 PP

                  GRAS 156 eeleetgerLakfAeelgvpfefnvl...vakrledleleeLrvkp.........gEalaVnlvlqlhrll...............des 217
                            ++ee+g +L +fA++ ++ +ef+++   +++ +++l +e+Lrv++          Eal++n++++lh+++               ++s
  HL.SW.v1.0.G014952.1 238 ISYEELGLKLVNFARSRNIILEFRLVhstYSDGFASL-IEHLRVQQhlvnyqqetPEALVINCHMMLHYIPeetlndintttssssSSS 325
                           99***********************855433344444.788888777777888889**************************9987666 PP

                  GRAS 218 vsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerr 306
                           +++ s r+ +Lk ++sl P+vvv+v+++ad++s++++ r+ +a+++ +  +d++++ lp+ s++r+++E+  ++++i+nv+a+eg +r+
  HL.SW.v1.0.G014952.1 326 TNTYSLRSMFLKSIRSLDPNVVVLVDEDADLTSNNLVCRLRSAFNFLWIPYDAVDTFLPKGSKQRQWYEAD-ISWKIENVIANEGVQRV 413
                           77777999***************************************************************.***************** PP

                  GRAS 307 erhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrve.eesgslvlgWkdrpLvsvSaW 373
                           er e ++kW +r+++a F++v ++e+a++++k++l +++  g+ ++ e+++ lvl+Wk++++v++++W
  HL.SW.v1.0.G014952.1 414 ERLEPKSKWVQRMRNASFRSVGFGEEAVSEVKTMLDEHA-AGWGLKkEDEDHLVLTWKGHNVVFATVW 480
                           ***************************************.55666536788999************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098540.93233461IPR005202Transcription factor GRAS
PfamPF035141.4E-8560480IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 488 aa     Download sequence    Send to blast
MMQFTTTSTS HEISTTPPIP PILCNNLPIM NKTQLSRGRP WPGFPTSKAL GSFGDANCME  60
QLLVHCANAI ESNDVTLAQQ ILWVLNNIAQ PEGDSNQRLT SAFLRALITR AARIGTSCIK  120
MLASAVVARP LLLQNQDDDN LNVVFNVPHR FSVIDFATFI DLTPWHRFGF TAANAAILEA  180
VEGFSVIHLV DLSSTHCMQI PTLVDAIASR NYEVTPIIKL TVVVAAEAND VVPPILDISY  240
EELGLKLVNF ARSRNIILEF RLVHSTYSDG FASLIEHLRV QQHLVNYQQE TPEALVINCH  300
MMLHYIPEET LNDINTTTSS SSSSSTNTYS LRSMFLKSIR SLDPNVVVLV DEDADLTSNN  360
LVCRLRSAFN FLWIPYDAVD TFLPKGSKQR QWYEADISWK IENVIANEGV QRVERLEPKS  420
KWVQRMRNAS FRSVGFGEEA VSEVKTMLDE HAAGWGLKKE DEDHLVLTWK GHNVVFATVW  480
MPAVTAA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B7e-505448282474Protein SHORT-ROOT
5b3h_B2e-505548229420Protein SHORT-ROOT
5b3h_E2e-505548229420Protein SHORT-ROOT
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022741309.10.0scarecrow-like protein 32
SwissprotQ9SN221e-177SCL32_ARATH; Scarecrow-like protein 32
TrEMBLA0A2P5FSJ00.0A0A2P5FSJ0_TREOI; GRAS transcription factor
STRINGEOX916400.0(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77023347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-179GRAS family protein