PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G014339.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family LBD
Protein Properties Length: 186aa    MW: 20648.3 Da    PI: 7.234
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G014339.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260142.71.1e-4461051100
                DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89 
                           +Ca+Ck+lrr+CakdC++apyfp+++p+kfa+vhk+FGasnv+k+l++lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lq+q++q
  HL.SW.v1.0.G014339.1   6 PCASCKLLRRRCAKDCIFAPYFPSDDPHKFAIVHKVFGASNVSKMLQELPLHQRADAVSSLVYEANARVRDPVYGCVGAISYLQSQVSQ 94 
                           7**************************************************************************************** PP

                DUF260  90 lkaelallkee 100
                           l+ +la++++e
  HL.SW.v1.0.G014339.1  95 LQMQLAVAQAE 105
                           *******9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.0125106IPR004883Lateral organ boundaries, LOB
PfamPF031956.4E-446103IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
Sequence ? help Back to Top
Protein Sequence    Length: 186 aa     Download sequence    Send to blast
MGGSSPCASC KLLRRRCAKD CIFAPYFPSD DPHKFAIVHK VFGASNVSKM LQELPLHQRA  60
DAVSSLVYEA NARVRDPVYG CVGAISYLQS QVSQLQMQLA VAQAEILCIQ MQQESTTCTL  120
PTQQMDQHHH HHQDHDQKPL ILSNTSNNST ITNFSTNLPQ YLSFSSSGNI NVMQDPTLQR  180
ESLWT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755183e-48HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004296053.12e-99PREDICTED: LOB domain-containing protein 12
SwissprotQ8LBW32e-78LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A061H0D57e-94A0A061H0D5_THECC; Lateral organ boundaries domain family protein
STRINGVIT_06s0004g07200.t011e-91(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.12e-63LBD family protein