PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G012853.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family HD-ZIP
Protein Properties Length: 342aa    MW: 39060.8 Da    PI: 7.0932
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G012853.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.31.3e-1894146456
                           -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
              Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                           + +++ eq+++Le+ Fe+ +++  e++ +LAk lgL+ rqV +WFqNrRa++k
  HL.SW.v1.0.G012853.1  94 KKRLNLEQVKTLEKSFEMGNKLEPERKMQLAKALGLQPRQVAIWFQNRRARWK 146
                           4568889*********************************************9 PP

2HD-ZIP_I/II131.23.9e-4292184193
           HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                           ekk+rl+ eqvk+LE+sFe+ +kLeperK++la++Lglqprqva+WFqnrRAR+ktkqlE+dy++Lk+++d lk++n++L++++++L++
  HL.SW.v1.0.G012853.1  92 EKKKRLNLEQVKTLEKSFEMGNKLEPERKMQLAKALGLQPRQVAIWFQNRRARWKTKQLERDYDVLKKQFDVLKADNDSLQDQNKKLHA 180
                           69**************************************************************************************9 PP

           HD-ZIP_I/II  90 elke 93 
                           el++
  HL.SW.v1.0.G012853.1 181 ELSS 184
                           9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.1E-1986150IPR009057Homeodomain-like
PROSITE profilePS5007117.13588148IPR001356Homeobox domain
SMARTSM003891.7E-1791152IPR001356Homeobox domain
CDDcd000868.50E-1693149No hitNo description
PfamPF000467.9E-1694146IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.1E-1996156IPR009057Homeodomain-like
PRINTSPR000311.1E-5119128IPR000047Helix-turn-helix motif
PROSITE patternPS000270123146IPR017970Homeobox, conserved site
PRINTSPR000311.1E-5128144IPR000047Helix-turn-helix motif
PfamPF021834.1E-16148188IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MAFPPHSFIF QSHQEDHRHQ QDHHHHLAPS TSSHHHPFHG GHHHAPFMMK RSLSFSGADE  60
NNHNHSNIIN KCTEEMLHGE DELSDDGSQL GEKKKRLNLE QVKTLEKSFE MGNKLEPERK  120
MQLAKALGLQ PRQVAIWFQN RRARWKTKQL ERDYDVLKKQ FDVLKADNDS LQDQNKKLHA  180
ELSSLKGRDI SNDSGRDHHH HHHHHHHQNF KKEAADQGSW SNGSDENSSD VNLDISRPPL  240
INTTTTTTTT SSASSQLVQN LFPSTLRPSS ITQLLQGSSS SRSDFQCLKQ ADPHHHHQLV  300
QSEESFCNLF VNGTTAATAT AGVEDQQPSF WPWPEQHNYF H*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1140148RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015879435.11e-124homeobox-leucine zipper protein ATHB-20-like
TrEMBLA0A2P5A9Z11e-158A0A2P5A9Z1_PARAD; Octamer-binding transcription factor
STRINGEMJ174831e-116(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127133106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15150.12e-69homeobox 3