PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G010120.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family Nin-like
Protein Properties Length: 649aa    MW: 71502 Da    PI: 6.5719
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G010120.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.11.7e-28329379252
                RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                           +++isl +l++yF++++kdAAk++gvc+T+LKriCRq+GI RWP+Rkik++
  HL.SW.v1.0.G010120.1 329 TENISLPVLRQYFAGSLKDAAKSIGVCPTTLKRICRQHGITRWPSRKIKKV 379
                           789**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.95318399IPR003035RWP-RK domain
PfamPF020422.2E-24331379IPR003035RWP-RK domain
SuperFamilySSF542772.68E-20533623No hitNo description
Gene3DG3DSA:3.10.20.2401.1E-20537618No hitNo description
PROSITE profilePS5174519.78538621IPR000270PB1 domain
SMARTSM006661.0E-18538621IPR000270PB1 domain
PfamPF005643.3E-15539620IPR000270PB1 domain
CDDcd064073.07E-31539620No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 649 aa     Download sequence    Send to blast
MPTFKAVVDL RSSQNFSPPS VCDELYQAVL TEIVEVLVSV CKTHRIPLAQ TWAPCHQQGH  60
AGENYARCVS SASLVSDLEL LGFHEACSQH HLFRGQGIVG AAFTTNKPCF ATDTTSFDKT  120
EYPLSHHARM FGLRAAVAIP LRSISAGSFF DFVLELFLPK DCQDPEEQKQ ISNSLSFVIQ  180
QACDCKSLRV IVEKELEEDR VMLPTGDQTV GATTTTTTNT TTYPVGVQSS GKESSWVDHM  240
MEAQQQGRGV SASLDYLTEE PDEEFRVTPH GVNLNHGDLP KGKVSTDFGQ LQKCSGSKES  300
SNGGADSHSF DCHSSSGARK AGEKRTRSTE NISLPVLRQY FAGSLKDAAK SIGVCPTTLK  360
RICRQHGITR WPSRKIKKVG HSLMKLQLMI DSVEGADGAI QIGSFYSSIP QLNSPKFPGN  420
NNDSSSSVNP SKQQYNQHLN SQSNSQLESG IYNHGLAMKP PSSMSSQASA LHQHKTTTFD  480
GFNGDSLITE DTSVILNGSC SSDRELLASS REENQIMDQT LPPLPENNVG IDSRNKSAFR  540
VKVNFGDKKI RFSLIANSSF RELQLEIMKR FNLDDIAMID IKYLDDDRDW ILLTCNADLQ  600
ECFELHSQSL NHKMRLCLQQ TSSEQRIEAS HFESSSSSHA SGNHYRPV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008235979.10.0PREDICTED: LOW QUALITY PROTEIN: protein NLP2-like
TrEMBLM5VGP20.0M5VGP2_PRUPE; Uncharacterized protein
STRINGVIT_03s0038g03710.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12373399
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.11e-151Nin-like family protein