PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G009614.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family GATA
Protein Properties Length: 344aa    MW: 37370.5 Da    PI: 4.9534
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G009614.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.86.2e-18260293134
                  GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                           Cs+C + kTp+WR gp g+ktLCnaCG+++++ +
  HL.SW.v1.0.G009614.1 260 CSHCLVQKTPQWRTGPLGPKTLCNACGVRFKSGR 293
                           *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169923.0E-8118333IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011410.936254290IPR000679Zinc finger, GATA-type
SMARTSM004011.9E-13254308IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.28E-13255316No hitNo description
Gene3DG3DSA:3.30.50.101.3E-13258291IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.25E-12259316No hitNo description
PROSITE patternPS003440260285IPR000679Zinc finger, GATA-type
PfamPF003201.1E-15260293IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MEGMEAKALR PSLRGELAQF ELFEEIYCST TNINNGAGLS CVPSEDFSID DLLNLQNGEF  60
EDGSVEEEEE EEEKYSLCVD EESLNVSGGY TGAGDSESAL TSELAVPDDD LAELEWVSHF  120
VDDSFSDFSL LHPIGKQRTE LHSENRFEQP EPTRTGTSPT CFPSVPVKTR TKRARPTTQS  180
WSRSNSLSPL TESSTSSSSS VASSPSSASF SSTPCLIFTN TVQAVEFLPS LSEPASKKQK  240
KKPAVQTGAA PVGPQFQRRC SHCLVQKTPQ WRTGPLGPKT LCNACGVRFK SGRLFPEYRP  300
ACSPTFSSEV HSNSHRKVLE MRKKKEVVGP GPGSGLTHVI SSF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010109771.11e-122hypothetical protein L484_008447
TrEMBLW9S3D01e-122W9S3D0_9R
STRINGPOPTR_0009s12620.11e-101(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.23e-48GATA transcription factor 5