PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G008768.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family LBD
Protein Properties Length: 148aa    MW: 16910 Da    PI: 4.5744
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G008768.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26045.22.7e-14368749100
                DUF260  49 lpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                           lp e r +a++++ +eA++r++ PvyG+vg+i++lqqq+++++++la +++e
  HL.SW.v1.0.G008768.1  36 LPVELRAEAADAIHFEAKCRMEFPVYGCVGIISQLQQQIQNVETQLAITRAE 87 
                           67889******************************************99887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031955.1E-123585IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 148 aa     Download sequence    Send to blast
MILAVLFANS EGNILVERFN GVPAEERLHW RPFLRLPVEL RAEAADAIHF EAKCRMEFPV  60
YGCVGIISQL QQQIQNVETQ LAITRAEIAF ITSNSADINV VQEQPHFQEE YSNLNHFNHS  120
FIQPQNDNII GQYDQMTNNS SSNWMNF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2P5DKN32e-39A0A2P5DKN3_TREOI; Lateral organ boundaries domain containing protein
STRINGXP_004140854.11e-20(Cucumis sativus)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.17e-17LOB domain-containing protein 24