PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G007962.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family LBD
Protein Properties Length: 111aa    MW: 12421.3 Da    PI: 7.8642
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G007962.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260116.41.8e-3671061100
                DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89 
                           +C +Ck+lrrkC+++C++apyf  eqp+kfanvhk+F asn  kll++l +++reda++sl+ye ++++rd vyG+vgvi+ lq+ql+q
  HL.SW.v1.0.G007962.1   7 PCTGCKLLRRKCQPECMFAPYFLPEQPQKFANVHKVFEASNAAKLLNELAPSHREDAVNSLAYEVDMQLRDLVYGCVGVITLLQHQLRQ 95 
                           7**************************************************************************************** PP

                DUF260  90 lkaelallkee 100
                           l+ +l+++k+e
  HL.SW.v1.0.G007962.1  96 LQMDLSSTKSE 106
                           ******99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089122.3286107IPR004883Lateral organ boundaries, LOB
PfamPF031952.0E-367104IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 111 aa     Download sequence    Send to blast
MASSNSPCTG CKLLRRKCQP ECMFAPYFLP EQPQKFANVH KVFEASNAAK LLNELAPSHR  60
EDAVNSLAYE VDMQLRDLVY GCVGVITLLQ HQLRQLQMDL SSTKSELSKY *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A9e-4731107114LOB family transfactor Ramosa2.1
5ly0_B9e-4731107114LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPromotes the switch from proliferation to differentiation in the embryo sac. Negative regulator of cell proliferation in the adaxial side of leaves. Regulates the formation of a symmetric lamina and the establishment of venation. Interacts directly with RS2 (rough sheath 2) to repress some knox homeobox genes. {ECO:0000269|PubMed:17209126}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_026423718.15e-61protein ASYMMETRIC LEAVES 2-like
RefseqXP_026423724.15e-61protein ASYMMETRIC LEAVES 2-like
SwissprotQ32SG37e-54LBD6_MAIZE; LOB domain-containing protein 6
TrEMBLA0A200PM642e-59A0A200PM64_9MAGN; Uncharacterized protein
TrEMBLA0A443NSI22e-59A0A443NSI2_9MAGN; LOB domain-containing protein 6-like protein
STRINGVIT_00s0340g00090.t011e-59(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96253043
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65620.43e-55LBD family protein