PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G007900.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family SBP
Protein Properties Length: 544aa    MW: 59137.1 Da    PI: 8.2845
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G007900.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.82.4e-41174250278
                           -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                   SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                           Cqv gC+++ls+ k+yh+rhkvCe hsk+++v+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk+q 
  HL.SW.v1.0.G007900.1 174 CQVYGCNKNLSSSKDYHKRHKVCELHSKTAKVIVNGIEQRFCQQCSRFHLLAEFDDGKRSCRKRLAGHNERRRKPQV 250
                           **************************************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.0E-32169235IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.847171248IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.47E-38173252IPR004333Transcription factor, SBP-box
PfamPF031101.3E-31174247IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 544 aa     Download sequence    Send to blast
MEPWSYVSTE KGLVTEETLP PFNSLARSKN VLLGWEFKTP CTYGNNMLVS SQQGIGNQGF  60
GEYIQMMGKQ VSNHSIGDVL SDPKDCGGKL NDPMMTVAFS GEDESSSRIS SSILDSGSWD  120
SSLIDLKLGH VGDRGDTSKS KLSIGAPAGL SSSESSTHPK RLRLSAVNSQ NGFCQVYGCN  180
KNLSSSKDYH KRHKVCELHS KTAKVIVNGI EQRFCQQCSR FHLLAEFDDG KRSCRKRLAG  240
HNERRRKPQV SIHSGRAGRM LQSYNDSRLQ GTASFICQDI LPSGFYNPEK YGTIDWTQRI  300
KVEDGSNLRL LSTNPVPATN GHLCSKLLFP HDAGKQFPSF HASGANAVTA NVFTKNNSIQ  360
YSHYMGGPDS SSRPFFHNTI LGCGDFNTFN TATTIQGFSG TSDSGCALSL LSSQPHSSSS  420
HLSGSSMVRP LVKPESHACY NVGQVSKKLV GASSSCVSNK LPSLGMNSVS GSYPNPIMMS  480
NGGDNVNFEI TDGMFQGSDF LSSKDRISCE DSPTINLLQL SSQLRRVDDQ RQSMQMKPED  540
DAF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-281732471084squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015883292.10.0squamosa promoter-binding-like protein 6
TrEMBLA0A2P5EBT10.0A0A2P5EBT1_TREOI; SBP-box transcription factor
STRINGEMJ102990.0(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.15e-47SBP family protein