PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G006244.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family LBD
Protein Properties Length: 278aa    MW: 29929.8 Da    PI: 7.131
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G006244.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260132.91.3e-4191081100
                DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleq 89 
                           +CaaCk+lrrkC+ +Cv+apyfp +qp+kfa+vhk++Gasnv k+l++lp  +re+a+ sl+yeA+ar+rdPvyG+vg+i+ l+++l+q
  HL.SW.v1.0.G006244.1   9 PCAACKFLRRKCTLECVFAPYFPPDQPQKFACVHKVYGASNVAKILNELPVAHREEAVVSLAYEAQARLRDPVYGCVGFISVLHNRLKQ 97 
                           7**************************************************************************************** PP

                DUF260  90 lkaelallkee 100
                           +++el+++k+e
  HL.SW.v1.0.G006244.1  98 VQTELNAAKKE 108
                           *******9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.6438109IPR004883Lateral organ boundaries, LOB
PfamPF031953.8E-419106IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MSSSSSHSPC AACKFLRRKC TLECVFAPYF PPDQPQKFAC VHKVYGASNV AKILNELPVA  60
HREEAVVSLA YEAQARLRDP VYGCVGFISV LHNRLKQVQT ELNAAKKELA AYIGPQAMMI  120
PSYSLSSMPP MFGIPPNVSI GQQHQQFMIQ DPANHHLQHP MFVESAAQAQ QQQMRFNNGF  180
DQMGVASVGD IGVGIGGVFN NQMSSSGGGG GGSGSPSPAA AGVMSPTLSL QGSFNNNIFN  240
SQMQPHQTTV LHHNTLDYQL QSQLLLQSQH NSEAEES*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A5e-4721224124LOB family transfactor Ramosa2.1
5ly0_B5e-4721224124LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtControls the proximal-distal patterning in petals and the adaxial-abaxial determination of leaves. Involved in the repression of the homeobox gene BP. {ECO:0000269|PubMed:12787254, ECO:0000269|PubMed:15821980}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008371805.12e-87LOB domain-containing protein 36-like
SwissprotQ9FKZ38e-62LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A2P5DEA81e-119A0A2P5DEA8_PARAD; Lateral organ boundaries domain containing protein
STRINGXP_008371805.18e-87(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.12e-59ASYMMETRIC LEAVES 2-like 1
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]
  2. Wang Z,Wang Y,Kohalmi SE,Amyot L,Hannoufa A
    SQUAMOSA PROMOTER BINDING PROTEIN-LIKE 2 controls floral organ development and plant fertility by activating ASYMMETRIC LEAVES 2 in Arabidopsis thaliana.
    Plant Mol. Biol., 2016. 92(6): p. 661-674
    [PMID:27605094]