PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G004978.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family GRF
Protein Properties Length: 408aa    MW: 45600.7 Da    PI: 10.1839
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G004978.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC72.45.1e-23104146244
                   WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                           +ep+rCrRtDGKkWRCs+++l+ +k+CErH+hrgr+rsrk ++
  HL.SW.v1.0.G004978.1 104 NEPWRCRRTDGKKWRCSKEALPHQKYCERHIHRGRHRSRKLVD 146
                           79**************************************987 PP

2WRC72.45.1e-23312354244
                   WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                           +ep+rCrRtDGKkWRCs+++l+ +k+CErH+hrgr+rsrk ++
  HL.SW.v1.0.G004978.1 312 NEPWRCRRTDGKKWRCSKEALPHQKYCERHIHRGRHRSRKLVD 354
                           79**************************************987 PP

3QLQ37.19.3e-144174336
                   QLQ  3 FTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                          FT  Ql++L  Q l+yKy+ a++PvP +L+q+i+
  HL.SW.v1.0.G004978.1 41 FTILQLHELQLQTLIYKYIEAGLPVPYNLVQPIW 74
                          7778*****************************9 PP

4QLQ37.19.3e-14249282336
                   QLQ   3 FTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36 
                           FT  Ql++L  Q l+yKy+ a++PvP +L+q+i+
  HL.SW.v1.0.G004978.1 249 FTILQLHELQLQTLIYKYIEAGLPVPYNLVQPIW 282
                           7778*****************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.9E-43975IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166618.6454075IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088806.6E-114174IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.31103147IPR014977WRC domain
PfamPF088791.2E-19105145IPR014977WRC domain
SMARTSM009512.9E-4247283IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166618.645248283IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088806.6E-11249282IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.31311355IPR014977WRC domain
PfamPF088791.2E-19313353IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 408 aa     Download sequence    Send to blast
MAHFTSSGFG QEEGSSQIGL NLELGRGVCQ NKRSSSSYHG FTILQLHELQ LQTLIYKYIE  60
AGLPVPYNLV QPIWQSFSSS ITGLNNGLGV VGPLCLDSRR GMENEPWRCR RTDGKKWRCS  120
KEALPHQKYC ERHIHRGRHR SRKLVDSCNS KTTTMANTST SNNGGGGIGS TMTDLSISLH  180
VNENNTRGFI FPRNGIGKLF LKYKISFATK NFLVKRFGQE EGSSQIGLNL ELGRGVCQNK  240
RSSSSYHGFT ILQLHELQLQ TLIYKYIEAG LPVPYNLVQP IWQSFSSSIT GLNNGLGVVG  300
PLCLDSRRGM ENEPWRCRRT DGKKWRCSKE ALPHQKYCER HIHRGRHRSR KLVDSCNSKT  360
TTMANTSTSN NGGGGIGSTM TDLSISLHVN ENNTRGFLFP RLDFQPN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015881992.15e-51PREDICTED: growth-regulating factor 10-like
SwissprotQ6EPP97e-39GRF10_ORYSJ; Growth-regulating factor 10
TrEMBLF6HUK89e-51F6HUK8_VITVI; Putative uncharacterized protein
STRINGVIT_02s0025g04910.t012e-50(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF141951017
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.12e-26growth-regulating factor 2