PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G002074.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family LBD
Protein Properties Length: 260aa    MW: 27365.3 Da    PI: 4.4788
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G002074.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260331.6e-108413054100
                DUF260  54 redamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                             ++++sl+yeA+ r+ +Pv G++g+++++++ l+++++e++l++e+
  HL.SW.v1.0.G002074.1  84 SAEIFKSLLYEACGRIVNPVGGSTGLVQSGSWYLCEAAVEAVLRGEP 130
                           5789************************************9988765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031951.1E-585124IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MAVESSDEAA PRAAPSDPAS TGSNPPNPNP TPLSSSPNST AAPDSSTSSM PAPSTVDLVI  60
FYKQYINISQ NDVQFSKTTF DFYSAEIFKS LLYEACGRIV NPVGGSTGLV QSGSWYLCEA  120
AVEAVLRGEP ITPVSAELAP GSSSVSGDIR HAAKRDGSVI RKVQSRRRLK RKVAKVEVQS  180
ETEFGTESAQ LVLSGPPVSH DSEGTRQLLS PGADSGEEDS GSVALAVKPK LGGVELELTL  240
GWAMWTFDKS ERSEEEDAN*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1165171RRRLKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015882967.13e-35LOB domain-containing protein 40-like
TrEMBLA0A2P5F9N53e-64A0A2P5F9N5_TREOI; Lateral organ boundaries domain containing protein
STRINGEOY210246e-34(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2539523
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67100.16e-27LOB domain-containing protein 40