PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G001848.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family GeBP
Protein Properties Length: 420aa    MW: 46360.1 Da    PI: 4.5303
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G001848.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573123.21.3e-38174270298
                DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkife 90 
                           +fqrlws++Dei +L+Glid+++k+gk+p++d++af ef+kk+++++v+k+ql++Ki rLKkK+  ++ k+++g+e ++sk+hd+k+fe
  HL.SW.v1.0.G001848.1 174 AFQRLWSDDDEIEILKGLIDYQSKKGKDPTADMNAFLEFIKKNLHVDVEKRQLSSKISRLKKKYLSNSGKVEKGEESVLSKPHDRKSFE 262
                           69*************************************************************************************** PP

                DUF573  91 lskkiWgs 98 
                           lskkiWgs
  HL.SW.v1.0.G001848.1 263 LSKKIWGS 270
                           ******95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045049.7E-34175269IPR007592Protein of unknown function DUF573
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005730Cellular Componentnucleolus
Sequence ? help Back to Top
Protein Sequence    Length: 420 aa     Download sequence    Send to blast
MAPRRLKEAP PPADSSSEES ESESEAGIEE ENGVAAEAGN GEKSSQEDDD EDDSEEEDED  60
DGEEDEKGKL SSHMIKEEES DSGSDSETDS DSDSDSDNTN PPSPTTADFT IKPSKSIEDS  120
VKSKVQKPTK PSVSTPAPAT PTTTSKRAAE KELDGKNSKK KKATDEEDPK QLSAFQRLWS  180
DDDEIEILKG LIDYQSKKGK DPTADMNAFL EFIKKNLHVD VEKRQLSSKI SRLKKKYLSN  240
SGKVEKGEES VLSKPHDRKS FELSKKIWGS TVTNGDGSED SARSAKNKSK PIVKSSDGEV  300
KTNPTDPDEF WSNYPCLTDS LKLVNSIPEN LMKQTLPLIA SSKLKELENK WKKLHMEGIE  360
LQNQRMFGYL LTKLTLQDGS RPLPNQGQWL WLKPSSSSLP EVSLVLPCYT CAVEPIRVD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2P5BT032e-89A0A2P5BT03_TREOI; DNA-binding storekeeper protein-related transcriptional regulator
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18313490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00390.11e-29DNA-binding storekeeper protein-related transcriptional regulator