PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G000914.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family HD-ZIP
Protein Properties Length: 387aa    MW: 42561.7 Da    PI: 8.0721
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G000914.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox573.2e-18212266256
                           T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
              Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                           rk+ +++k+q   Lee F+++++++ ++++ LAk+l+L  rqV vWFqNrRa+ k
  HL.SW.v1.0.G000914.1 212 RKKLRLSKDQSAFLEESFKEHNTLNPKQKQALAKQLNLRPRQVEVWFQNRRARTK 266
                           788899***********************************************98 PP

2HD-ZIP_I/II1278.4e-41212302192
           HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLre 89 
                           +kk+rlsk+q+++LEesF+e+++L+p++K++la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr 
  HL.SW.v1.0.G000914.1 212 RKKLRLSKDQSAFLEESFKEHNTLNPKQKQALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLNKELQELR- 299
                           69*************************************************************************************9. PP

           HD-ZIP_I/II  90 elk 92 
                           +lk
  HL.SW.v1.0.G000914.1 300 ALK 302
                           555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.2E-18188269IPR009057Homeodomain-like
SuperFamilySSF466892.4E-18200269IPR009057Homeodomain-like
PROSITE profilePS5007117.443208268IPR001356Homeobox domain
SMARTSM003899.3E-16210272IPR001356Homeobox domain
CDDcd000862.33E-16212269No hitNo description
PfamPF000461.4E-15212266IPR001356Homeobox domain
PROSITE patternPS000270243266IPR017970Homeobox, conserved site
SMARTSM003404.6E-25268311IPR003106Leucine zipper, homeobox-associated
PfamPF021832.0E-10268302IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 387 aa     Download sequence    Send to blast
MELGLSLGDP PKPFGFVEKH HRDRDHSNND KASPFCMDLS IGPLRSRGGE ENGRQGELNS  60
KEQKRRRDEI SQIEGTTTTN NGKSGSSSEP PVQLDLLPHT PVPRSHGGSG FPWSSSAEIH  120
DGGSAGCGIL ELSRVSKVVV HTSAAEEADD TTALSSSPNS NSGGTSSFQM DIGLYSYRGS  180
GGNNKRDQYS EGEAERSSPR ASDDDDVNGN NRKKLRLSKD QSAFLEESFK EHNTLNPKQK  240
QALAKQLNLR PRQVEVWFQN RRARTKLKQT EVDCEYLKRC CETLTEENRR LNKELQELRA  300
LKTSNPFYMQ LPATTLTMCP SCERVATTTN TVTNPSSTNP TSNNNESSSS KSAAGFPLNR  360
PKFYPFPQAQ TQAQTQTYTH QSSTAS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1260268RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010095880.11e-142homeobox-leucine zipper protein HOX11
SwissprotP466652e-91HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLA0A2P5DZS91e-149A0A2P5DZS9_PARAD; Octamer-binding transcription factor
STRINGXP_010095880.11e-141(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23353382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.16e-85homeobox from Arabidopsis thaliana