PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID HL.SW.v1.0.G000893.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Humulus
Family HB-other
Protein Properties Length: 494aa    MW: 55834 Da    PI: 7.8831
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
HL.SW.v1.0.G000893.1genomeHOPBASEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox634.3e-201974257
                          T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
              Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                          +kR+  t++q+ +Le+++++++yp++e++ eLA++lgLte+q++ WF+ rR k+k+
  HL.SW.v1.0.G000893.1 19 KKRRLKTPSQVMALEKFYNEHKYPTEEMKSELAEQLGLTEKQISGWFCHRRLKDKR 74
                          89****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.7E-22274IPR009057Homeodomain-like
PROSITE profilePS5007117.6861575IPR001356Homeobox domain
SuperFamilySSF466899.41E-191783IPR009057Homeodomain-like
SMARTSM003891.2E-201779IPR001356Homeobox domain
CDDcd000862.28E-181974No hitNo description
PfamPF000461.9E-171974IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 494 aa     Download sequence    Send to blast
MEESSEAHSE EKKASQDNKK RRLKTPSQVM ALEKFYNEHK YPTEEMKSEL AEQLGLTEKQ  60
ISGWFCHRRL KDKRLSRDEP CANGRQDRLS GVIQDLGSGL GQDSCGSTKH VDYRYVDPRE  120
VESQRLFGND FPAADLTNDK RSLYTERVSG MDDTSSESCS SLQDRLLSHT EDPRSVETFR  180
YLAQDGPIAP LSSKGTRTVG YKPSGYLKVK NEIENAAITA VKRQLGKQYR EDGPPLGVEF  240
EPLPPGAFES PIRDPKYEVN NSKLSSKDPY MHQEAPGIIH GIGHQEAKPS NLLRQKSTYI  300
DHASSVPGRN FSDNYDDSSY NNNRHRKKGS KHGVEGMSSD SFHNRLSHYS GKVASKQTFS  360
RVHEDDDVSP EIMQRSEYLK FKPSVSARNY CEAPDMDERG LSTIMAQEDK FIGEGKARKD  420
VKVAKRGRAD FSRQENCTNS SLVEMLPHLP WRCHQASARM KLQKPVLQQG EVSGKHEEGV  480
SLGLYSWRES YDR*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11823KKRRLK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010106869.10.0E3 ubiquitin-protein ligase HERC2
TrEMBLW9RV990.0W9RV99_9R
STRINGGLYMA14G03850.11e-144(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF57923051
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G03250.11e-79HB-other family protein