PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KDD76345.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Chlorellales
Family SBP
Protein Properties Length: 540aa    MW: 57780.1 Da    PI: 5.068
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KDD76345.1genomeUBCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP81.41.3e-255701277
                TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
         SBP 12 seakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77
                 ++ +y rr++vCe+h++++++l +g++qrfCqqC+rf ++ ef+ ++rsCr+rL+ hn+rrrk+q
  KDD76345.1  5 GHLTRYLRRYRVCEFHARCESILKDGRRQRFCQQCGRFQDVAEFEGARRSCRQRLDLHNSRRRKRQ 70
                56789***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114122.281169IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.53E-21470IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.106.1E-19456IPR004333Transcription factor, SBP-box
PfamPF031101.3E-22568IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 540 aa     Download sequence    Send to blast
RLPLGHLTRY LRRYRVCEFH ARCESILKDG RRQRFCQQCG RFQDVAEFEG ARRSCRQRLD  60
LHNSRRRKRQ RWGGSREGQG GGSFPWEPAP TPLPTRALQS AQNLPFPSED PELLTRLLQT  120
LAATHGWLVQ GLKIRSLNSM GVGEEEAAPD IFEVHDGGEA RGRGQGADAM GLGSRAETTQ  180
HGLGSLARSA PHLALPHPPN PAALALQSMQ QALTEYTRAV GAGGVQVGGG FPPVVSPFLP  240
DTLALPAGPP PFGPAPLTVQ HPALLPLSMD HLVRSELDAA VPGRSICLPT GRLVCPNVHA  300
EHPSPGLALD PTSPSRSAGL EPLAISVERS PYSLLASAES EQGRWPQGST LDTDGVPIPT  360
VEDASFTVQL LEALEQPMPP REETEYVSTA NLNQATEERG ALAHSTPASP SARLPQLCLA  420
LPASLSPLAS SSPLASPSPL ASPSPLAPPF VEAEASLGIP EVHPELDLGM GLDVLDMEAS  480
TDRAFADFAL DDEPDGIHAA RFKDLSPSDG PELPEEPPHL PDSFSRLVRL DTIQLAEMEL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-1910682684squamosa promoter binding protein-like 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A059LQF50.0A0A059LQF5_9CHLO; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP2012101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.11e-06squamosa promoter binding protein-like 8