PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KDD75586.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Chlorellales
Family SBP
Protein Properties Length: 156aa    MW: 17755 Da    PI: 7.697
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KDD75586.1genomeUBCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP78.31.2e-2475141167
                 --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT CS
         SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLa 67 
                 +Cq+ gC+++lse+key+rr+++C +h    +++++g +  fCqqC+rf  +++fD++k++Crr++ 
  KDD75586.1  75 ACQIVGCHSNLSELKEYYRRYRICPHHMGLHSIVLNGSTSCFCQQCGRFQPVEDFDDDKKTCRRKVR 141
                 5***************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.108.9E-2370137IPR004333Transcription factor, SBP-box
PROSITE profilePS5114120.03373150IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.14E-2275142IPR004333Transcription factor, SBP-box
PfamPF031105.0E-2376142IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010468Biological Processregulation of gene expression
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 156 aa     Download sequence    Send to blast
MPYVVEDVLM FSGEEYHRPW KWEDWGWDPS ALTASRDVTS KASAQDEPKS SALDAPQESV  60
NHELKKCQAV SKECACQIVG CHSNLSELKE YYRRYRICPH HMGLHSIVLN GSTSCFCQQC  120
GRFQPVEDFD DDKKTCRRKV RTGAVQTPRA SRARAA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul5_A3e-1476140670squamosa promoter binding protein-like 7
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A059LN371e-114A0A059LN37_9CHLO; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP2012101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.18e-17SBP family protein