PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Han007842
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Asteroideae; Heliantheae alliance; Heliantheae; Helianthus
Family WRKY
Protein Properties Length: 173aa    MW: 18998.4 Da    PI: 5.3349
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-169a-Helianthus_annuus-28210PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY57.52.8e-18141171333
                -SS-EEEEEEE--TT-SS-EEEEEE-STT-- CS
       WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCp 33 
                DgynWrKYGqK vkg++f rsYY+Ct+ +Cp
  Han007842 141 DGYNWRKYGQKLVKGNTFVRSYYKCTFGNCP 171
                9*****************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.1E-15133171IPR003657WRKY domain
PROSITE profilePS5081115.503134173IPR003657WRKY domain
SuperFamilySSF1182902.62E-15136171IPR003657WRKY domain
SMARTSM007744.0E-7139172IPR003657WRKY domain
PfamPF031066.1E-13141171IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MDKSSDSVEL TNDSNSGDPS NQETKSESTK VKESHDSSNQ EGSSTTVLPN KELDAQNDKP  60
TLHTESARSE SVKEENTLTD SSQQTPASEP DDKNNIVPLR PEKGLDKLPL RRNADNVTVA  120
QFAHPYQGGT VAKVPEKPTG DGYNWRKYGQ KLVKGNTFVR SYYKCTFGNC PGX
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021989483.11e-121WRKY transcription factor SUSIBA2-like
TrEMBLA0A251TM091e-120A0A251TM09_HELAN; Putative WRKY domain-containing protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G04880.23e-16zinc-dependent activator protein-1