PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN48637.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB_related
Protein Properties Length: 288aa    MW: 31371.9 Da    PI: 9.0861
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN48637.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.53.5e-1482126347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++ + ++ G+g+W+ I++   k+Rt+ q+ s+ qky
       KHN48637.1  82 PWTEEEHKLFLVGLQKVGKGDWRGISKNYVKTRTPTQVASHAQKY 126
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.26275131IPR017930Myb domain
SuperFamilySSF466892.99E-1777132IPR009057Homeodomain-like
TIGRFAMsTIGR015579.1E-1778129IPR006447Myb domain, plants
SMARTSM007173.9E-1079129IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.9E-1181126IPR009057Homeodomain-like
PfamPF002495.7E-1282126IPR001005SANT/Myb domain
CDDcd001677.58E-1082127No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MSRASSAADS AASGEIILFG VRVVVDSMRK SVSMNNLSQY EHPLDATTTN NNKDAAGYAS  60
ADDAAPQNSG RLRERERKRG VPWTEEEHKL FLVGLQKVGK GDWRGISKNY VKTRTPTQVA  120
SHAQKYFLRR SNLNRRRRRS SLFDITTDTV SAIPMEEEQV QNQDTLCHSQ QQPVFPAETS  180
KINGFPAMPV YQFGVGSSGV ISVQVQGTGN PMEELTLGQG NVEKHNVPNK VSTVSDIITP  240
SSSSSAVDPP TLSLGLSFSS DQRQTSSRHS ALHAMQCFSN GDSIISVA
Functional Description ? help Back to Top
Source Description
UniProtBinds selectively to the DNA sequence 5'-[GA]GATAA-3' and may act as a transcription factor involved in the regulation of drought-responsive genes. Enhances stomatal closure in response to abscisic acid (ABA). Confers drought and salt tolerance. {ECO:0000269|PubMed:21030505}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00631PBMTransfer from PK23829.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapKHN48637.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by drought, high salinity, and ABA. {ECO:0000269|PubMed:21030505}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ5502090.0FJ550209.1 Glycine max cultivar Harosoy63 isoflavonoid regulator (MYB176) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001236048.20.0transcription factor MYB176
RefseqXP_028231455.10.0transcription factor MYB1R1-like
SwissprotQ2V9B04e-68MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLA0A445KIN10.0A0A445KIN1_GLYSO; Transcription factor MYB1R1
TrEMBLD8L1Z50.0D8L1Z5_SOYBN; Isoflavonoid regulator
STRINGGLYMA05G01640.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42483154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74840.24e-48MYB_related family protein
Publications ? help Back to Top
  1. Shin D, et al.
    Expression of StMYB1R-1, a novel potato single MYB-like domain transcription factor, increases drought tolerance.
    Plant Physiol., 2011. 155(1): p. 421-32
    [PMID:21030505]
  2. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]